CAZyme Information: MGYG000002297_01202

Basic Information

• Species: TF01-11 sp001916135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11; TF01-11 sp001916135
• CAZyme ID: MGYG000002297_01202
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
262	MGYG000002297_9|CGC1	28767.97	10.1713

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002297	3127107	Isolate	China	Asia

• Gene Location: Start: 45841; End: 46629 Strand: -

Full Sequence      

MSQMKEKMNQMKSHIGKIFMAAAFIVIVVGLTGAVLAEISGRNPAEKKSQSGTVASGAAD
VTGTVSDELTRTAEAAGITPVKRHGALHVSGTDLKDCHGAKFRLKGVSTHGIAWFPQYVN
KDAFQTLRDNYGINTIRLAMYTNKSEGYGPDAVNKVREGVKYATELGMYVIIDWHILNDG
NPNQHKSEAKKFFTKMSKKYGGQKNVIYEICNEPNGNVTWNKQIKPYAKTIVKTIRKHSK
NAVIVIGTPTWSQDVDVVAQSH

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	98	261	2.4e-61	0.6835443037974683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	4.43e-51	96	259	2	178	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	2.14e-15	105	262	68	240	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
COG3867	GanB	3.22e-05	111	175	55	125	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	0.001	121	175	27	79	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK83877.1	8.39e-73	56	260	203	413
QWT53734.1	6.19e-69	74	259	208	397
QNM00780.1	6.19e-69	79	260	213	398
AWW27905.1	2.98e-68	79	259	220	406
CBK83458.1	3.74e-68	79	253	40	219

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XZW_A	2.11e-69	79	259	4	188	Endo-glucanasechimera C10 [uncultured bacterium]
6GJF_A	1.26e-68	77	261	3	188	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZB_A	4.91e-68	79	259	4	189	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
3PZT_A	4.05e-67	73	262	22	213	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
1A3H_A	1.92e-58	81	262	3	186	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	1.83e-64	73	262	27	218	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	1.41e-63	73	262	27	218	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P23549	2.79e-63	64	262	18	218	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
Q59394	1.03e-60	75	262	29	217	Endoglucanase N OS=Pectobacterium atrosepticum OX=29471 GN=celN PE=3 SV=1
Q47096	5.63e-60	75	262	29	217	Endoglucanase 5 OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=celV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.722266	0.272656	0.001678	0.000646	0.000387	0.002382

TMHMM  Annotations     

start	end
13	35