CAZyme Information: MGYG000002293_01144

Basic Information

• Species: Prevotella sp900557255
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557255
• CAZyme ID: MGYG000002293_01144
• CAZy Family: CE12
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		36670.18	10.0068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002293	3611909	Isolate	China	Asia

• Gene Location: Start: 19806; End: 20798 Strand: -

Full Sequence      

MKKIKAILCVFILALLMTSSTKTTTIFVIGDSTAAEKGGFRNNPERGWGMVLQGFFDDKV
IVDNHAVNGRSSLSFINEGRWKKVLDRIKPGDYVFIQFGHNDEKSMPDRHTDPGSNFDAN
LARYVNETRAKGGIPVLFNAVVRRCYYSAELKNDDDEKLRNKVYDGREQINSDTLIDTHG
AYVIAPRNVAKQLNVPFVDATKITHDIETGMGIEGSRKLHMWFMPGENPQVPKGKKDNTH
YNVYGARVVAGALADAVAEQVPALKSHVCHYDYVVSAEGRGNFMDLQKAVDAVPVGKKAV
IRILGGEWKKPIIAKGKKIKFVKSFGAKIK

Enzyme Prediction     

No EC number prediction in MGYG000002293_01144.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE12	25	256	1.4e-72	0.9904761904761905

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd01821	Rhamnogalacturan_acetylesterase_like	1.78e-78	24	257	1	198	Rhamnogalacturan_acetylesterase_like subgroup of SGNH-hydrolases. Rhamnogalacturan acetylesterase removes acetyl esters from rhamnogalacturonan substrates, and renders them susceptible to degradation by rhamnogalacturonases. Rhamnogalacturonans are highly branched regions in pectic polysaccharides, consisting of repeating -(1,2)-L-Rha-(1,4)-D-GalUA disaccharide units, with many rhamnose residues substituted by neutral oligosaccharides such as arabinans, galactans and arabinogalactans. Extracellular enzymes participating in the degradation of plant cell wall polymers, such as Rhamnogalacturonan acetylesterase, would typically be found in saprophytic and plant pathogenic fungi and bacteria.
COG2755	TesA	1.90e-23	16	265	1	216	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
pfam13472	Lipase_GDSL_2	3.45e-11	28	248	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
cd00229	SGNH_hydrolase	7.77e-08	26	182	1	157	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
cd01838	Isoamyl_acetate_hydrolase_like	3.06e-06	26	199	2	161	Isoamyl-acetate hydrolyzing esterase-like proteins. SGNH_hydrolase subfamily similar to the Saccharomyces cerevisiae IAH1. IAH1 may be the major esterase that hydrolyses isoamyl acetate in sake mash. The SGNH-family of hydrolases is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT66075.1	4.21e-242	1	330	1	330
AGB27919.1	7.20e-142	2	329	4	330
BCS86649.1	9.74e-133	16	323	1	307
QIM10157.1	1.56e-126	1	323	5	326
VEH15653.1	1.92e-114	11	309	11	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1DEO_A	5.83e-15	24	266	1	221	RHAMNOGALACTURONANACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.55 A RESOLUTION WITH SO4 IN THE ACTIVE SITE [Aspergillus aculeatus],1DEX_A RHAMNOGALACTURONAN ACETYLESTERASE FROM ASPERGILLUS ACULEATUS AT 1.9 A RESOLUTION [Aspergillus aculeatus],1K7C_A Rhamnogalacturonan acetylesterase with seven N-linked carbohydrate residues distributed at two N-glycosylation sites refined at 1.12 A resolution [Aspergillus aculeatus],1PP4_A The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus],1PP4_B The crystal structure of rhamnogalacturonan acetylesterase in space group P3121 [Aspergillus aculeatus]
3C1U_A	1.09e-14	24	106	1	79	ChainA, Rhamnogalacturonan acetylesterase [Aspergillus aculeatus]
2O14_A	5.24e-11	25	150	164	287	X-RayCrystal Structure of Protein YXIM_BACsu from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR595 [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31523	3.36e-40	22	280	4	229	Rhamnogalacturonan acetylesterase RhgT OS=Bacillus subtilis (strain 168) OX=224308 GN=rhgT PE=1 SV=1
O31528	4.80e-27	26	259	5	204	Probable rhamnogalacturonan acetylesterase YesY OS=Bacillus subtilis (strain 168) OX=224308 GN=yesY PE=1 SV=1
Q00017	2.21e-14	20	266	14	238	Rhamnogalacturonan acetylesterase OS=Aspergillus aculeatus OX=5053 GN=rha1 PE=1 SV=1
Q5BAA2	1.86e-11	20	273	14	240	Rhamnogalacturonan acetylesterase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=AN2528 PE=1 SV=1
P42304	6.80e-11	25	150	179	302	Uncharacterized esterase YxiM OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiM PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003329	0.554499	0.441502	0.000208	0.000211	0.000225

TMHMM  Annotations     

start	end
7	29