CAZyme Information: MGYG000002293_00832

Basic Information

• Species: Prevotella sp900557255
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557255
• CAZyme ID: MGYG000002293_00832
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
661	MGYG000002293_6|CGC1	75621.26	6.9611

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002293	3611909	Isolate	China	Asia

• Gene Location: Start: 77314; End: 79299 Strand: +

Full Sequence      

MVKKLFFIATLLYIGATVSAENYLVKSPDGKIVAELNTNKSLSLQFKYNGSILLQESSIG
VTLNDGTDMGKNPKVASHKLSNHKETIHAPFYRQQNFETAYQELNLKLTNGFGIILRAYD
EGVAYRFYTQRKDKTIILNETAAYQFGKDKKAWLPYTTTPEKPFAMAFQNIYHETRLDTA
KQDLAFLPATIDCGKAKVTILESDLEKYPSMWLKANSSEQDKEKGILRAAFAPYPKEMAY
YPWRHMSHVKSTCDYIATSTGKRNYPWRIFAITEHDTQMPTNNLVYALAAPNKIGDTSWI
KPGKVAWDWWNDWNLKGVDFKAGINFDTYKYYIDFAHKHGLEYIVLDEGWYNSKEGSILK
PIDDIQLPKLIEYGKSKGVDIVLWAVFNVMDENLETICKTYADMGIKGFKVDFMDRDDQT
AIEMVERLAACTAKHHLILDLHGIYKPHGLNRTYPNILNYESVFGMEECRWTEAKNDMPL
YDVTFPYIRMMAGQVDFTPGAMRNGTRDNWKAIYTKPISMGTRCHQAACYIVQDSPFTML
ADTPTNYEADEPYTRYIASLPVVFDKTIVPQGEIGKYIVTARKKGNDWYVGGQSNWDERT
LTLKFDFLADGDYEAIVLKDGINANHDAEDYKIEKYDIHQNSEMKIHLASGGGFVIKVIK
K

Enzyme Prediction     

No EC number prediction in MGYG000002293_00832.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	15	657	2e-191	0.9857369255150554

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	4.45e-124	296	561	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.81e-56	27	291	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	3.69e-40	564	659	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS84570.1	0.0	11	661	11	655
ALK83458.1	7.17e-285	8	658	12	661
ABR38815.1	1.76e-283	21	658	28	661
QQY38934.1	1.76e-283	21	658	28	661
QEW34704.1	3.53e-283	3	658	5	661

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	2.42e-195	27	658	6	640	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	4.38e-194	27	658	20	654	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQC_A	1.17e-55	25	657	3	657	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	1.60e-55	25	657	3	657	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	4.16e-55	25	657	3	657	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	3.30e-195	3	658	2	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	1.74e-53	38	592	55	561	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	6.77e-35	3	658	4	723	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000221	0.999173	0.000163	0.000147	0.000143	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002293_00832.