CAZyme Information: MGYG000002293_00194

Basic Information

• Species: Prevotella sp900557255
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900557255
• CAZyme ID: MGYG000002293_00194
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
244	MGYG000002293_1|CGC4	27912.57	10.1913

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002293	3611909	Isolate	China	Asia

• Gene Location: Start: 214326; End: 215060 Strand: -

Full Sequence      

MILKKIKNIVKWVVVLFFSTTILAVVAYRFIPVYVTPLMFIRCFQQVADGESITLHHHWV
SMDKISPHMPVAVMASEDARFLKHLGFDFNAIESAAKNNARGGKVHGASTISQQTAKNVF
LWPGRSWTRKGFEVYFTFLIEMMWSKQRIMEVYLNSIEMGPGIYGVDAVAEYHFDKKAKD
LFRGECALIAATLPNPRKFSSLHPSAYMKKRQRQIEHQMRFIPTFPREGEDFDPGTAVGG
YRGK

Enzyme Prediction     

No EC number prediction in MGYG000002293_00194.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	56	219	5.1e-53	0.9265536723163842

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	9.08e-116	2	228	4	234	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.68e-88	4	220	1	219	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	3.38e-68	56	220	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	1.22e-65	3	220	9	241	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	2.49e-38	6	219	1	230	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT65514.1	1.06e-176	1	244	1	244
ALO48142.1	1.58e-130	3	240	1	238
AGB29041.1	8.43e-121	10	240	2	230
VEH15611.1	1.76e-120	8	240	7	240
QUB46829.1	1.68e-118	5	231	3	230

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	5.71e-29	59	231	22	196	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	8.02e-29	59	231	22	196	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
3DWK_A	3.50e-21	57	206	27	178	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
2OLU_A	2.23e-20	57	206	36	187	StructuralInsight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Apoenzyme [Staphylococcus aureus],2OLV_A Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus],2OLV_B Structural Insight Into the Transglycosylation Step Of Bacterial Cell Wall Biosynthesis : Donor Ligand Complex [Staphylococcus aureus]
4OON_A	1.46e-19	72	220	54	204	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A8H2	9.98e-96	3	226	7	230	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=mtgA PE=3 SV=1
Q3V7G2	1.18e-89	3	226	3	226	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=mtgA PE=3 SV=1
Q3V815	1.18e-89	3	226	3	226	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=mtgA PE=3 SV=1
Q3V7R3	1.80e-69	11	230	10	230	Biosynthetic peptidoglycan transglycosylase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) OX=264462 GN=mtgA PE=3 SV=1
C3K3M0	3.45e-67	1	219	4	218	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000024	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35