CAZyme Information: MGYG000002291_02537

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_02537
• CAZy Family: GH87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
665	MGYG000002291_16|CGC1	74735.95	4.8441

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 35545; End: 37542 Strand: -

Full Sequence      

MRNFLYLLSALFISNLNLSAQSIAFPDDDIERGYYDRPYKRYEAEPDRCAGNASFLSPTV
LQTELQSEASNQMAAQLTEKGSYIQWTNDEAADGLTIRFSLPDSEDGKGTKGTLALYVND
EYVQDITLDSYWAWQYTLKYGNNKYPDNTPASNKFPRMRFDESHYKLAKKIPAGSTFKIV
KTTDNSSVYTIDFIELEPIPAAITFDDITDDNKIIFDDPTKNLGAFIQVNGGKTIFIPEG
RYEVDRKINITSDNTKIIGAGMWYTELYFTASSDDRSTYNKRGIETDNSNIVIEGLYINT
INNKRYYDNNANYQVGKGFMGSFGANSIIRNVWVEHFECGGWIANYNGKNSDNLLIQHSR
FRNNYADGLNLCSGIKNAIVEKCSFRNNGDDDMASWSSSELCINNIYRYNTAENNWRASS
LGFFGGQQNKASHCVIIDPMEAGLRVNCDFAGKGFGTEGYNEFNDISIYRGGVNNGTPGV
EGDFWGNRQGAIHIASSAYYDLQNIKFENINLYDSKNDAIHIASSNHKIKNLQMKNIHIN
GTGRYGIFYDNAQGNGFYCSMSYENIGAETDTNDKPDSFIFIEDCNPQGMHPVNEEDNLK
VYSINGSIILSGCRNIQISIYDITGRECYQAISSSDKITIPGFKPGLYIVKSDTDTVGKK
IFVKK

Enzyme Prediction     

No EC number prediction in MGYG000002291_02537.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH87	36	571	2e-133	0.8341708542713567

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14490	CBM6-CBM35-CBM36_like_1	6.10e-47	38	196	5	156	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
TIGR04183	Por_Secre_tail	8.22e-04	615	664	20	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
pfam18962	Por_Secre_tail	0.002	609	663	12	72	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALM50452.1	7.88e-129	11	589	23	583
AOE54071.1	7.88e-129	11	589	23	583
AOC97073.1	1.11e-126	31	575	34	567
QSB25510.1	2.51e-124	7	575	17	566
ABQ06220.1	1.43e-122	31	575	34	567

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZRU_A	1.82e-89	38	547	17	528	ChainA, Alpha-1,3-glucanase [Niallia circulans],5ZRU_C Chain C, Alpha-1,3-glucanase [Niallia circulans]
6K0M_A	2.42e-35	38	555	18	500	Catalyticdomain of GH87 alpha-1,3-glucanase from Paenibacillus glycanilyticus FH11 [Paenibacillus glycanilyticus],6K0N_A Catalytic domain of GH87 alpha-1,3-glucanase in complex with nigerose [Paenibacillus glycanilyticus]
6K0P_A	2.63e-34	38	555	18	500	Catalyticdomain of GH87 alpha-1,3-glucanase D1045A in complex with nigerose [Paenibacillus glycanilyticus]
6K0S_A	2.63e-34	38	555	18	500	Catalyticdomain of GH87 alpha-1,3-glucanase D1069A in complex with nigerose [Paenibacillus glycanilyticus],6K0V_A Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_B Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_C Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus],6K0V_D Catalytic domain of GH87 alpha-1,3-glucanase D1069A in complex with tetrasaccharides [Paenibacillus glycanilyticus]
6K0Q_A	1.02e-30	38	555	18	500	Catalyticdomain of GH87 alpha-1,3-glucanase D1068A in complex with nigerose [Paenibacillus glycanilyticus],6K0U_A Catalytic domain of GH87 alpha-1,3-glucanase D1068A in complex with tetrasaccharides [Paenibacillus glycanilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000315	0.999088	0.000155	0.000149	0.000144	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_02537.