CAZyme Information: MGYG000002291_00073

Basic Information

• Species: OM05-12 sp003438995
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; OM05-12; OM05-12 sp003438995
• CAZyme ID: MGYG000002291_00073
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
453	MGYG000002291_1|CGC1	52473.14	6.572

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002291	4475595	Isolate	China	Asia

• Gene Location: Start: 77287; End: 78648 Strand: -

Full Sequence      

MLKRISLYFLFMLGVWTIQAQEDRWQKNNADFSRGALRVNSSGSYLEYGDGTSFLYLGDT
AWELISRLTDEETEYYMEDRREKGVTVIQTVILDELNGIDNITACGYRQLINGDINRPDS
NYFARVDRVLACAASKGLYVALLPTWGDKVDKKWGMGPEIFNEENAFHYGQWLGARYVSV
PNLIWIIGGDRSGEGNKSRIWNALANGIRSIDQGHLMTFHPHGEHSSSFWFHDEEWLSFN
MIQTGHAQRNYAIYRKLLLPDLQKKPHKPCLDGESRYEGIPIGFKVENGRFNDYDIRTTL
YQSMFSGACGYTYGCNNVWQMFDYKHTPMCNANKPWNESLNEPGAWDLIHFRRLWEKYDF
REGSQQQNVICNSQMSDDNYPVAFGNHKYLLVYLPEGGKITLRISQMDKKQKTLSWMNPR
TGENSFYKKVDLREFSAYAPSMGKGNDWVLIIE

Enzyme Prediction     

No EC number prediction in MGYG000002291_00073.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	35	450	2.6e-138	0.9975728155339806

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	3.56e-142	43	358	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
pfam12904	Collagen_bind_2	2.82e-15	367	453	4	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL39863.1	1.52e-230	1	453	1	453
QUT26203.1	6.79e-227	1	453	1	453
QUR45524.1	6.79e-227	1	453	1	453
CBK67194.1	1.37e-226	1	453	1	453
ALJ47662.1	2.76e-226	1	453	1	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	2.69e-76	22	452	3	444	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
4QFU_A	2.13e-73	27	452	21	460	ChainA, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_B Chain B, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_C Chain C, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_D Chain D, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_E Chain E, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_F Chain F, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_G Chain G, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_H Chain H, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_I Chain I, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_J Chain J, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_K Chain K, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482],4QFU_L Chain L, glycoside hydrolase family 5 [Phocaeicola vulgatus ATCC 8482]
3KZS_A	2.04e-71	22	452	3	444	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000302	0.998970	0.000194	0.000174	0.000168	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002291_00073.