CAZyme Information: MGYG000002285_01063

Basic Information

• Species: CAG-95 sp900066375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; CAG-95; CAG-95 sp900066375
• CAZyme ID: MGYG000002285_01063
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
481	MGYG000002285_4|CGC1	55630.53	5.5604

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002285	3374269	Isolate	China	Asia

• Gene Location: Start: 118477; End: 119922 Strand: +

Full Sequence      

MKKILFVASEGVPFIKTGGLADVVGSLPKCIDKEYFDVRVILPKYTCMKQEMKDKLSYVT
HFYMDFHWKNEYVGVLYAEVDGVKYYFIDNEMFFNGFKPYSDNALFEIEKFAFFSKAALS
ILPVIDFRPDVIHCHDWQTGLIPVYLKERFQGSDFYRGIKSVMTIHNLKFQGKWGIREVQ
DITGLPDYYFTADKLEAYKDANLLKGGIVFADAITTVSATYAEEIKTAFYGEGLDGLLRA
RSKDLRGIVNGIDTDVFNPETDKNIEFNYNAMNFRKEKIRNKRALQAELGLEQDDKKFMI
GIVSRLTDQKGFDLISYVMDELCQSNVQIVVLGTGEERYENMFRHFDWKYNNKVSANIYY
SDALSHKIYAASDAFLMPSLFEPCGLSQLMSLRYGTVPIVRETGGLKDTVEPYNEYESTG
TGFSFTNYNAHEMLGTIYYAEKIYYEKKREWNKIVDRAMAADFSWNVSAKKYQEMYDWLI
G

Enzyme Prediction     

EC	2.4.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	3	476	1.3e-183	0.9936440677966102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0297	GlgA	0.0	3	481	2	480	Glycogen synthase [Carbohydrate transport and metabolism].
TIGR02095	glgA	0.0	3	476	2	470	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK00654	glgA	0.0	3	481	2	465	glycogen synthase GlgA.
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	3	476	1	472	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK14099	PRK14099	1.15e-120	3	480	5	480	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM03353.1	1.50e-300	1	481	1	481
ADL33995.1	1.67e-297	1	479	1	479
AOZ96211.1	4.77e-297	1	479	1	479
QBE99117.1	2.71e-282	1	481	1	480
QMW77767.1	7.75e-282	1	481	1	480

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D1J_A	2.27e-91	3	476	2	473	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	4.00e-91	3	476	2	473	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	3.13e-90	3	476	2	473	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
1RZU_A	7.69e-84	4	480	3	476	ChainA, Glycogen synthase 1 [Agrobacterium tumefaciens],1RZU_B Chain B, Glycogen synthase 1 [Agrobacterium tumefaciens]
6GNE_A	5.56e-83	4	476	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C4Z0G2	1.19e-260	1	477	1	476	Glycogen synthase OS=Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4) OX=515620 GN=glgA PE=3 SV=1
A9KMA3	1.01e-240	1	477	1	476	Glycogen synthase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=glgA PE=3 SV=1
A0PY73	3.62e-166	4	476	3	472	Glycogen synthase OS=Clostridium novyi (strain NT) OX=386415 GN=glgA PE=3 SV=1
Q97GX6	5.11e-163	3	476	2	473	Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=glgA PE=3 SV=1
A4J4I4	5.25e-161	3	480	2	475	Glycogen synthase OS=Desulfotomaculum reducens (strain MI-1) OX=349161 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002285_01063.