CAZyme Information: MGYG000002283_00913

Basic Information

• Species: Bacillus_A paranthracis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae_G; Bacillus_A; Bacillus_A paranthracis
• CAZyme ID: MGYG000002283_00913
• CAZy Family: GH101
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1458	MGYG000002283_1|CGC10	162211.1	6.0355

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002283	5102264	Isolate	China	Asia

• Gene Location: Start: 889889; End: 894265 Strand: +

Full Sequence      

MENKHFKRVFNTLLACMLIVPTLLVSMIVPRHVGANTSNPWVTISSVGNEINALIEQNGK
SYARLGAGAGNDNGAKAAVFQEQNKVAKESGTMEYSFIPETKGQDTRFGFYPHYIDNNNF
VFVGYDSLGWFYEYKYQGKGEWLKTRPNVPLPEAGTSHSIKIDYNKTTLNITLDGKDLFG
PVTLSNDVNTLLTGKEAIKLGAYGDKNSQVLIELGKAPGDGGTDPGNEKLVDITDNKLEE
GDLKIISGDGKVTYNEDGSATFGVTSTQKNRIVYNQMKAIKNGVFEADVTTNTDKMNRFG
FIYRVQNSSTYTYVGTGDTNDQYFGETFGPINNWTSMTSNVPLKAKQTYHLRLVFMDDVA
TLYIDGKKVDSWTLTGGVDQAGLLGFEKSRGAADITISNVKIKEYSAPKPPDTQPVENII
KSKYMDVTIDQVFPRIVKYKVGDKVMSGQEAPVYGLKVNGGLYYPKVNFEKLNDSEALYT
LKVVDEMKNLDAVFKVSVKVNDNKVVYSFDEIKNNGSAKIETVEFADMNFISVNSEQKGA
KAKLTNISTDVRKTGDVDVSVDSSMGEIGTSTKNYTAFLSADELSAGVWSSSEVDGYKNL
VANRYVNKNGAKAMGIGSSALYYQRDFMPEPQKDKPTIKIAIAKDLNNDNKADWQDAAIA
YRDIMQDIKGYQDVNNNVGMRIAMNFGSQAQQPFLKTSDNVKKVALATDELGQAVILKGY
ANEGHDSGHPDYGDVGERMGGVKDLNTLIKEGHKYNTQFGVHINAQETYPEAKAFNNDFI
DRPSSLGWGWLDQSYTINKLKDLYSGSRAKRLDELKTTVPDLDFIYLDVWYQNQWESNRI
ADQFKDRGWRLTTEFGGSMANYSTWQHWATDKNYGGPESKGINSEVLRFINNHQRDSWVL
NWPEVGGTADHPLLGGFELAGFEGWQSDKNFDNFIRMTFDTNLPTKFLQKYYITNWTNVE
GDKSKTNLEKEIKLKDPSNGDVVDVTRKDNARERVIKLNGNVILDGHAYLIPWVKQDFKN
PTPDSEKLYHWNLEGGTTTWTLPDEYKNATTVYVYKLTDQGRTDVKEVKVVNNKITLTAS
AATPYVVVPKRDKGLEIFDYNWGKDAHIYDGGFNTGKVSAYTTIEGDNKAVSVIRTNQTG
NNRNVSSGDYYLNIDSPSKDTTVSRVLTRLESGKDYVAEVYVENNSDVKAGITVTGGKED
ASNYTLRSLQKNYVKADSHATNDGYNSKMQIMQVSFTAVSNRAKLTLSRDSGKGNTKFDD
IRIVQKSLKNNVSPTEFKQDFESVVQGIYPFVIGNTEGVEDNRIHLSELHAPYTQKGWAG
KKLVDDVLGGNWSVKVNTGNKGLLYRTIPQNYRFEPGVTYKVSFDYQTTANAFRFISGDQ
EIDVRDIASAKGLSVNNTLTASTDTKRAEFTVTGSENAQTYVGIFSDGTNLNGDTGAGTF
ILDNLRIEKVTTGGETQR

Enzyme Prediction     

EC	3.2.1.97

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	422	1088	2.1e-286	0.9957567185289957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12905	Glyco_hydro_101	1.79e-135	655	935	1	273	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
cd14244	GH_101_like	6.12e-129	669	958	2	298	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam17974	GalBD_like	4.65e-66	1259	1437	1	184	Galactose-binding domain-like. Proteins containing a galactose-binding domain-like fold can be found in several different protein families, in both eukaryotes and prokaryotes. The common function of these domains is to bind to specific ligands, such as cell-surface-attached carbohydrate substrates for galactose oxidase and sialidase, phospholipids on the outer side of the mammalian cell membrane for coagulation factor Va, membrane-anchored ephrin for the Eph family of receptor tyrosine kinases, and a complex of broken single-stranded DNA and DNA polymerase beta for XRCC1. The structure of the galactose-binding domain-like members consists of a beta-sandwich, in which the strands making up the sheets exhibit a jellyroll fold.
pfam18080	Gal_mutarotas_3	4.01e-64	420	654	1	243	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	1.22e-33	942	1063	2	111	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYY26584.1	0.0	1	1458	1	1458
ACJ78453.1	0.0	1	1458	1	1458
QPA46722.1	0.0	1	1458	1	1458
QGG19952.1	0.0	1	1458	1	1458
QPA40969.1	0.0	1	1458	1	1458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QEP_A	8.51e-254	420	1457	12	1123	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
6SH9_B	9.26e-254	420	1457	12	1123	EngBFDARPin Fusion 4b D12 [Bifidobacterium longum subsp. longum JCM 1217]
6QEV_B	9.26e-254	420	1457	12	1123	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]
6QFK_A	9.26e-254	420	1457	12	1123	EngBFDARPin Fusion 4b G10 [Bifidobacterium longum]
2ZXQ_A	1.58e-253	420	1457	27	1138	Crystalstructure of endo-alpha-N-acetylgalactosaminidase from Bifidobacterium longum (EngBF) [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8DR60	2.01e-227	41	1455	125	1423	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1
Q2MGH6	7.66e-227	41	1455	125	1423	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1
A9WNA0	1.57e-145	420	1456	52	1043	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001122	0.998006	0.000288	0.000222	0.000169	0.000166

TMHMM  Annotations     

start	end
13	35