CAZyme Information: MGYG000002282_02930

Basic Information

• Species: Parabacteroides gordonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides gordonii
• CAZyme ID: MGYG000002282_02930
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382	MGYG000002282_8|CGC2	43668.95	5.7774

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002282	6348794	Isolate	China	Asia

• Gene Location: Start: 61888; End: 63036 Strand: -

Full Sequence      

MDFKLMPLKHIAAAMMLGFVTISSWAAPVPAEKPSGLDRAEVLSVARKVADWQVKEFPNN
PYAVKEPKGWIAGALYLGMYDWAELSGEEGYFNWLKKVFNRQYWQVADRMYHADDVCVSQ
TYIDMYNKYKEEKMLLPTLARIDWVINNPSKGGLDIDYSKPLSYERWSWCDALFMAPGVY
TRLYTLTGNKKYMIFSDAEFKATYNHLYDKEEHLFFRDSRYFNQKEANGKKVFWGRGNGW
VIGGLAEILKTLPENDTEYRPFYQQLFCELSERLAALQSKDGFWHASLLDPDSYPSPETS
ATGFIVYGLAYGVNQGYLPADKYLPVIEKGWKALVSAVEPDGKLGWVQPVGADPKKVTRD
MTELYGTGALLMAAVEIYKLSE

Enzyme Prediction     

No EC number prediction in MGYG000002282_02930.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	67	379	3.5e-88	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	6.56e-104	45	380	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	6.76e-52	69	381	35	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48952.1	1.17e-215	35	382	93	440
QUT74307.1	1.64e-157	39	380	25	366
QGT72377.1	4.23e-156	39	382	26	370
QIU93743.1	4.55e-155	35	382	451	795
ASM65072.1	5.24e-155	39	381	28	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.56e-74	30	380	17	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.53e-57	82	376	84	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	4.52e-48	81	376	66	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3K11_A	6.28e-17	234	344	264	371	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF04	1.63e-83	45	377	60	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	1.59e-80	36	382	28	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	1.71e-73	30	380	24	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
O31521	6.11e-12	70	347	31	299	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000262	0.998994	0.000200	0.000186	0.000162	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002282_02930.