CAZyme Information: MGYG000002282_02409

Basic Information

• Species: Parabacteroides gordonii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides gordonii
• CAZyme ID: MGYG000002282_02409
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000002282_6|CGC2	44636.44	8.0497

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002282	6348794	Isolate	China	Asia

• Gene Location: Start: 55833; End: 57008 Strand: +

Full Sequence      

MTFLYWIELVLFICFLINIAYLLFFSIASLSKGKQLRDFSSKDHKRIAILIPAYKEDQVI
MECVHSCMQQLYPKDKYDIVVISDRMEEETNMSLSALPVKLVKVFFGNSTKAKALNYAME
QIGDSYDIAVVLDADNVIYPDFLNEMNNIFSESHVQIVQAHRKAKNLNTNLSILDAVSEE
INNSIFRLGHARVGLSAALIGSGMAFDYPLFKDIMLTIDAVGGFDRALELSLLKEGKRIY
YLSEVDVLDEKVQSHANFSNQRRRWLSAQIHYLGRFIGDVPAALLKGNWDFCDKVFQQMS
IPRILLLGMTFVISVFLSFIAGGLSVKWWILFFLLILALLLAIPSSLFNKRLMIALFELP
YSFLLMFCNLFRLKGANKKFIHTSHGVEDKK

Enzyme Prediction     

No EC number prediction in MGYG000002282_02409.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	46	266	2.7e-29	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13641	Glyco_tranf_2_3	3.40e-31	44	266	1	228	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06423	CESA_like	3.65e-29	49	225	1	173	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.68e-26	1	329	13	341	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06438	EpsO_like	2.58e-25	49	214	1	170	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06421	CESA_CelA_like	1.78e-15	46	265	2	226	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT47278.1	1.13e-150	11	387	12	387
QRQ47855.1	1.13e-150	11	387	12	387
QQA31495.1	2.29e-148	11	390	12	390
QUT63139.1	2.29e-148	11	390	12	390
QUT19178.1	3.49e-147	8	388	8	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	2.13e-06	47	151	15	118	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3VA59	2.04e-06	47	240	4	206	Dolichyl N-acetyl-alpha-D-glucosaminyl phosphate 3-beta-D-2,3-diacetamido-2,3-dideoxy-beta-D-glucuronosyltransferase OS=Methanococcus voltae OX=2188 GN=aglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	29
304	326
328	347
352	371