CAZyme Information: MGYG000002273_04894

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_04894
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389	MGYG000002273_57|CGC1	44877.64	6.5988

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 11976; End: 13145 Strand: -

Full Sequence      

MLADFFYHNDVIDPLKEQCDDLGTKHTNTFIPKVLAEARNYELTKSAESRTLADFFWHTM
INHHTFAPGCSSDKEHFFDPKQFSKHLTGYTGETCCTYNMLKLSRHLFCWTGDASIADYY
ERALYNHILGQQDPETGMVTYFLPLLSGSHKVYSTQENSFWCCVGSGFENHAKYGEAIYY
HNDKGIYVNLFIPSEVNWEEKEMIIRQETAFPAEETTALTIHAKKPVETTVYLRYPSWSK
KVTVKVNGKRVSVKQKPGSYIAVTRQWKDGDKIEANYPMEIQLETTPDNPQKGALIYGPL
VLAGELGTEGMQSPAPFSNPELYNDYYTYNYHIPAGLNTTLQVDLKHPERCLQRTGKSLE
FRNQQGTLLKPLYDLHRQRYVVYWDLKTE

Enzyme Prediction     

EC	3.2.1.185

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	2	303	1e-126	0.6003976143141153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.70e-138	2	303	199	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.44e-91	2	307	202	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU00179.1	7.66e-257	2	389	254	641
QUT34119.1	7.66e-257	2	389	254	641
QUT92215.1	2.94e-254	2	386	254	638
ALJ62034.1	8.40e-254	2	386	254	638
QIU95281.1	2.63e-245	2	389	253	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	5.48e-80	2	389	238	653	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	5.81e-78	2	389	238	653	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_04894.