CAZyme Information: MGYG000002273_02456

Basic Information

• Species: Bacteroides stercorirosoris
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides stercorirosoris
• CAZyme ID: MGYG000002273_02456
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
774	MGYG000002273_14|CGC2	88404.12	6.8134

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002273	6091524	Isolate	China	Asia

• Gene Location: Start: 35296; End: 37620 Strand: -

Full Sequence      

MKKGILSLFLFLITQLCWAQFNLPSGKPVKVFCDNAEEKVVHTALDLLSRDCKAVLSASL
LVDNEQGDIIIGTVGRSPLIAKTGADVSGLNGKKQAFLLTVLPDGKLLVAGSDAHGTAYG
IMELSRLIGVSPWEWWADVVPEKKTSFTLPADYQTTQSPSVEYRGIFINDEDWGLMPWSS
KNYEPADQQQIGPKTNRRIFELLLRLRANTYWPAMHECTLPFFLTKGNREVAAEFGIFIG
SSHCEPMVCSAAGEWRRRGEGDYDYVNNSASVYKFWEDRVKEVAGQENIYTLGMRGVHDG
QMQGAKTVEEQKAVLERVLKDQRGLLEKYVNKDVTAIPQAFIPYKEVLDIYNAGLKVPDD
VTLIWCDDNYGYIRHFPTPEEQARKGGNGIYYHVSYWGRPHDYLWLGTFSPYLLYQQMKL
AYDRGIQKMWVLNVGDIKPAEYQIELFLDMAWNIEQVAEEGVTTHLKNWLGREFGTEYAE
TLLPVMQEHYRLAYIRKPEFMGNTREEERDPIYKKVKDLPWSEQTICERLKDYAALSSVV
EEVEAKLPVHRKDAYMQLVKYPVQAADQMNRKLLNAQLARHGKVDWEQSDAAFDSIASLT
RRYNALQNGKWIHMMDFQPRKLPVFKRVAHETAVTPMVNEKTPAYKWNAMDCTAGNPLQC
EGLGYEGKAAGIGKNTSLTFAFDDWKTDSVEVQIRLLPNHPMDEKQLRFTLSVDKSAPQT
VSYETKGRSEEWKENVLRNQAIRKVKLPVNKRKSHKLVIKALDEGVVLDQIMLY

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	20	771	6.4e-250	0.9956958393113343

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	0.0	157	500	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	3.28e-14	677	774	57	159	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EDV07550.1	0.0	1	774	1	774
ALJ58886.1	0.0	1	774	1	775
QUT89997.1	0.0	1	774	1	775
QDO67466.1	0.0	1	774	1	778
QQA08841.1	0.0	1	774	1	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5BY3_A	0.0	21	774	20	774	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4ZMH_A	4.55e-104	59	613	58	608	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
4C90_A	1.79e-100	25	615	49	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
7PXQ_A	1.44e-94	23	615	19	624	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]
7PUG_A	1.47e-94	23	615	20	625	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000266	0.999061	0.000209	0.000143	0.000143	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002273_02456.