CAZyme Information: MGYG000002271_00213

Basic Information

• Species: GCA-900066135 sp900066135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; GCA-900066135; GCA-900066135 sp900066135
• CAZyme ID: MGYG000002271_00213
• CAZy Family: GH95
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	MGYG000002271_1|CGC2	97853.52	5.4316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002271	3727782	Isolate	China	Asia

• Gene Location: Start: 225528; End: 228095 Strand: -

Full Sequence      

MDSDSCKKIVEHVPLERDSTILDYGGKMRDYYLREYTPAETFSDAYYMGNGRLGLTSKGT
VPQETLHINDDTLWSGSESFHKNAQHYECMLEARKKVLSGNVKEANQIINDEMEGRWFET
YLPMADLHLTVGQRDNRRNMPLKQVIEPEPGDISEYERKLDLSRAVCSVSWKRDEISYQQ
QYFVSYPEDAAFVFIQARGKEEHCLNLAFGMDSKLHAVNGTMDEGAYVRGIAPDHAEPSY
TTITPSLVYNDQEESKALRFACCAEVFETNGKVWADGRRVYVNDADYVWIIIKTGTSYEG
FQKKRFKGEKEIQEKLQKEIQKFKRKKCSGEQVFAEHQKDYQTLYNRVDLDLGRDRGEKM
ATSQRMVFSTGGMDDPSLYALYFQYARYLIISGSRPESQPLNLQGIWNDITMPPWSSNYT
NNINVEMNYWLTEAGNLSECHLPLMRLIRELSIAGKQTAKEYYHSAGWVTHHNTDLWRST
EPSCEDASWSWWPLGGGWLCEHIWQHYEYTGDKKFLEEMYPVLKGACEFLLEQLVENGEG
YLVTAPSISPENKFFMGNAEELDALAEEMAAGSRCSSNHPKISAVTQASTMDMSILRELF
QNTIQAGNILGEKKDLENKLKAVMQKFPPYKIGRYGQLLEWYEDYEECTPGMGHISHLYP
VYPSSVINEEKTPELLEAARKSLERRMLHEKKESDWPGAWRVSLMARFKNSLECGHILKS
IGENFGCGLLTKGSQQIDAIFGTGAGVKEMLLQSHQGYVEILPCIPVDWPDGNFQGLCAR
GGYEVSAVWKEGQLQSAVIFSKNGGNCRVKAVGLKKVEGMEGTWDETHKIYKFVTEPGKE
YHLLFECRQQKEYFV

Enzyme Prediction     

No EC number prediction in MGYG000002271_00213.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH95	33	812	4.6e-228	0.9764542936288089

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14498	Glyco_hyd_65N_2	3.94e-43	33	300	1	233	Glycosyl hydrolase family 65, N-terminal domain. This domain represents a domain found to the N-terminus of the glycosyl hydrolase 65 family catalytic domain.
pfam06202	GDE_C	0.003	484	524	82	114	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ97128.1	1.41e-233	21	810	4	791
BCZ44164.1	3.86e-187	38	844	18	787
QGH20126.1	1.19e-179	27	810	4	746
QGH24161.1	1.19e-179	27	810	4	746
QMW92850.1	3.73e-178	27	810	4	746

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RDY_A	6.23e-142	38	843	10	789	ChainA, BH0842 protein [Halalkalibacterium halodurans C-125],2RDY_B Chain B, BH0842 protein [Halalkalibacterium halodurans C-125]
4UFC_A	3.86e-133	38	821	29	759	Crystalstructure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus],4UFC_B Crystal structure of the GH95 enzyme BACOVA_03438 [Bacteroides ovatus]
7KMQ_A	2.41e-125	38	813	48	761	ChainA, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306],7KMQ_B Chain B, Glyco_hyd_65N_2 domain-containing protein [Xanthomonas citri pv. citri str. 306]
2EAB_A	2.16e-53	49	855	55	894	Crystalstructure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAB_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum (apo form) [Bifidobacterium bifidum],2EAC_A Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum],2EAC_B Crystal structure of 1,2-a-L-fucosidase from Bifidobacterium bifidum in complex with deoxyfuconojirimycin [Bifidobacterium bifidum]
2EAD_A	2.91e-53	49	855	55	894	ChainA, Alpha-fucosidase [Bifidobacterium bifidum],2EAD_B Chain B, Alpha-fucosidase [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L7W8	1.94e-125	38	814	59	817	Alpha-L-fucosidase 2 OS=Arabidopsis thaliana OX=3702 GN=FUC95A PE=1 SV=1
A2R797	1.14e-59	45	791	38	758	Probable alpha-fucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=afcA PE=3 SV=1
Q5AU81	1.44e-48	46	812	44	799	Alpha-fucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afcA PE=1 SV=1
Q2USL3	1.91e-37	40	815	27	718	Probable alpha-fucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=afcA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002271_00213.