CAZyme Information: MGYG000002270_01603

Basic Information

• Species: Enterococcus_A avium
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A avium
• CAZyme ID: MGYG000002270_01603
• CAZy Family: GH65
• CAZyme Description: Alpha,alpha-trehalose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712	MGYG000002270_13|CGC1	82950.05	5.095

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002270	4464845	Isolate	China	Asia

• Gene Location: Start: 33522; End: 35660 Strand: +

Full Sequence      

MKIYLNDYETETLEKAESLLFNGNGYIGLRGNLEEDYYDHFSTNRETYINGFYETKELHY
PEKMYGFTPTGETMISVIDGQTTLITIGGEQFSIMEGTISDSERYLDMEKGITVRNLVWT
SPQGRQTKITISRLISFHYKNLFSLKIDFERLNHQEEIELTTHLNFYPVRTIDKNDPRMS
HDLQKIVIKEIDLAKKSCVFGTEYSQLEAELVWSIDNQTVEQTIEEDRIVIRTKLEGDSY
QKNLSYAFQQQKHEKIECSFAKLVQKQIEFLNDFWQSAKVNIKSTDNLEESVNYSTFALL
QSLGTNHTTSIAAKGLSGSGYEGHYFWDAEMFVFPVFLHLNPLLAKQLLTYRYTTLDKAR
ENRQLFGYQTGALYPWRTISGTESSPFFEGGSAQHHINADIAYAFIQYYRYTDDLAFIAD
CGFEVLLETARVFSEIGYMKNGKFHIDKITGPDEYTVLVNDNYYTNQLVAYQFQWLNRFA
KLLREHHPESWSDLNKKLQLQESELQDFAQFSAAMALPFDEEKGIIAQDRDFLNKSFWPY
SKEETNYPLLLNYHPLTIYRYQISKQADAVLALMLFPDSFDKKTTAKSVAYYDEVTTHDS
SLSYSTFSTVYSRLGQVEKGYEYFIKNARTDLDNSHKNTKDGIHTASMGGTFMSIVYGFC
NLQIVEDRLTIDPHLPAEIDEIDFYTYFKNQKYRVYVSHQEHWIEKVAKEHQ

Enzyme Prediction     

EC	2.4.1.64

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	294	665	4.1e-124	0.989247311827957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	9.95e-167	2	700	12	736	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	6.72e-116	294	669	2	387	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	1.86e-96	2	710	11	735	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	8.06e-39	6	183	3	174	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ11772.1	0.0	1	712	1	712
QEH67578.1	8.26e-189	6	698	10	724
AZS17789.1	2.89e-187	2	710	4	736
ANY73296.1	4.35e-187	2	691	4	718
ACX62781.1	1.74e-186	7	691	9	717

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIQ_A	5.81e-86	11	689	16	721	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
1H54_A	6.29e-62	3	697	12	724	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]
4KTR_A	9.61e-53	3	701	16	728	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTP_A	1.78e-52	3	701	16	728	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
7FE3_A	2.42e-34	261	664	275	642	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GRC3	3.04e-186	6	678	8	704	Alpha,alpha-trehalose phosphorylase OS=Geobacillus stearothermophilus OX=1422 GN=treP PE=1 SV=1
Q8L164	1.26e-153	8	695	22	740	Alpha,alpha-trehalose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=treP PE=1 SV=1
P9WN12	4.77e-107	13	684	24	709	Uncharacterized glycosyl hydrolase MT3509 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3509 PE=3 SV=1
P9WN13	4.77e-107	13	684	24	709	Uncharacterized glycosyl hydrolase Rv3401 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3401 PE=1 SV=1
Q49736	4.19e-98	13	684	24	709	Uncharacterized glycosyl hydrolase ML0392 OS=Mycobacterium leprae (strain TN) OX=272631 GN=ML0392 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999877	0.000160	0.000018	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002270_01603.