CAZyme Information: MGYG000002270_01095

Basic Information

• Species: Enterococcus_A avium
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_A; Enterococcus_A avium
• CAZyme ID: MGYG000002270_01095
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
474	MGYG000002270_8|CGC4	54569.59	4.5052

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002270	4464845	Isolate	China	Asia

• Gene Location: Start: 66222; End: 67646 Strand: -

Full Sequence      

MTFTNDFLWGGSIAAHQCEGAWQEDGKGPAIMDFVTKGSNKEPRVITETIDPTLDYPSHL
GIDFYHHYQEDIKLFKEMGFTVLRISIDWSRIFPKGDEQEPNQAGLDFYDKVIDELLANG
IEPIVTLYHFELPIHLVREYGSWKNRQVIDFYLHYCETVMRAYDGKVKYWVTFNEMNHID
PQSEQSDIFTYLIAGLKYSEMENSVEELAKIGYNMTLAAVKAVRLGRELNPENKIGCVFG
LNPIYSYDCHPDNVLKAFLDNDRDYYQVDAMCNGKFPKYKMKQYQALALDLGNQPEDVED
FAKGTIDFIGLNYYMSSLSEPNRPVEGESALFGGLQNPYLEQSKWGWGIDPTGIRYVMNY
LYRKYELPILITENGLGAIDQLADGTVHDDYRIEYLEKHIKAVKQAVEEDFVECMGYLTW
GPIDLVSATTGEMSKRYGFIYVDLDNEGQGSLQRLKKDSFDWYKKVIKSNGEDL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	471	3.4e-141	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	1	473	2	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09589	celA	0.0	1	474	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	2.61e-176	2	474	3	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09593	arb	3.95e-175	1	474	4	477	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	7.59e-172	1	474	4	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYQ26138.1	0.0	1	474	1	474
QCQ14168.1	0.0	1	474	1	474
BBM17440.1	0.0	1	474	1	474
AXG40595.1	0.0	1	474	1	474
AXU32943.1	5.39e-265	1	474	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	3.15e-168	1	474	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.32e-167	6	474	10	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	3.75e-167	6	474	10	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	5.27e-162	6	474	10	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]
3QOM_A	2.84e-154	3	474	11	480	Crystalstructure of 6-phospho-beta-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],4GZE_A Chain A, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_B Chain B, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_C Chain C, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_D Chain D, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_E Chain E, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1],4GZE_F Chain F, 6-phospho-beta-glucosidase [Lactiplantibacillus plantarum WCFS1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42973	9.89e-172	6	474	7	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46829	1.73e-167	1	474	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
Q46130	1.78e-150	1	474	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P40740	2.04e-148	3	474	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	1.37e-147	3	474	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002270_01095.