CAZyme Information: MGYG000002269_00849

Basic Information

• Species: Anaerococcus nagyae
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus nagyae
• CAZyme ID: MGYG000002269_00849
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	MGYG000002269_3|CGC1	54579.26	4.7654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002269	1825027	Isolate	China	Asia

• Gene Location: Start: 80450; End: 81871 Strand: +

Full Sequence      

MAFRKDFLWGGATAANQCEGAFDENGKGLANVDLCPVGDDRQAIITGQKKMFDFDKEHFY
PAKNSIDMYHRYKEDIALFAEMGFKVYRFSIAWTRIFPNGDESKPNEAGLKFYENLIDEC
HKYNIEPLITITHFDFPMHLVHEYGGWRNRKIVDFYQNLVTAIFTRFKGKVKYYLTFNEI
NVILAASFMGAGLYFEEGEDINKVRAQAIHHELLASAYATKIAHEIDPEIKIGCMLAAGT
YYPATCKPEDVFAAQKYNRDNYFFVDVQSRGYYPSYKLKEYELSGIMPEMHEEDEKILRE
NTVDFISFSYYTTRTISSDASNFDESNLVDTVDNPYLGKTEWGWQIDPLGFRTTINEIWD
RYQKPLFVVENGLGAKDTPNENGYVEDDYRIAYLRDHIKNMKDTVEVDGVDLLGYTTWGP
IDLVSAGTGEMSKRYGFIYVDRDDYGNGSLDRSKKKSFDWYKKVIASNGEDLD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	469	3.8e-144	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15014	PRK15014	0.0	5	472	8	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	473	2	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	473	4	478	6-phospho-beta-glucosidase; Reviewed
PRK09589	celA	0.0	1	472	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	473	4	474	cryptic 6-phospho-beta-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUY65046.1	5.90e-280	1	473	1	473
QZO75755.1	5.90e-280	1	473	1	473
BBM55890.1	4.87e-272	1	473	1	473
BBM56200.1	2.81e-271	1	473	1	473
BBM50965.1	1.62e-270	1	473	1	473

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	2.32e-197	3	472	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.87e-174	1	472	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	7.80e-174	5	472	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	2.22e-173	5	472	9	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	1.93e-169	5	472	9	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	1.32e-209	3	473	4	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	1.20e-194	3	472	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q48409	1.14e-176	3	472	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P42973	7.72e-176	5	472	6	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
Q46130	1.45e-174	1	473	5	472	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002269_00849.