CAZyme Information: MGYG000002267_01485

Basic Information

• Species: Eisenbergiella sp003478085
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp003478085
• CAZyme ID: MGYG000002267_01485
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000002267_4|CGC4	43702.95	4.7974

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002267	7234430	Isolate	China	Asia

• Gene Location: Start: 130549; End: 131682 Strand: +

Full Sequence      

MLQEIDKKLQKLINAFTGILYEDDDVFMENMRRKKKLSEEELRKYAHWEWTQGVGLYGIW
KLFAASGEKKYLEMLTRYYDRQLQVGFPQCNVNTAAPFLTMSYLAEYLKDENYMKPCREA
AEWIMNGMPRTMEGGIQHMTSDDVNEQELWDDTLVMTVLFLANMGRILDREDYRNEAQYQ
FLLHMKYLQDPISGFWYHGWTFLERNHFAGAFWGRGNCWSTIAIPELLSMISCPEPVERI
LKETLCSQVEALSRCQADSGMWHTLLDDPESYEEASATCGFAYGILRGVHSGLLEEKWLA
AADRALNPILSLISEDGVLGQVSYGTPMGRESRDFYKEIPLKPMPYGQALAILFLVEWKR
GHKGSEQLLYTSKQEDI

Enzyme Prediction     

No EC number prediction in MGYG000002267_01485.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	41	360	1e-98	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.63e-106	40	357	26	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	2.44e-96	24	360	3	341	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR00386.1	6.89e-160	4	360	7	362
ANU44854.1	6.89e-160	4	360	7	362
QEH70918.1	1.02e-158	3	357	4	357
BCJ96760.1	2.40e-155	4	357	8	360
QHQ59825.1	2.51e-153	5	358	9	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	6.56e-97	8	362	25	380	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.83e-96	8	360	26	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	1.54e-87	4	360	7	370	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	3.58e-25	40	329	31	336	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.52e-24	40	329	21	326	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	7.30e-65	48	357	29	334	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.96e-24	40	329	31	336	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002267_01485.