CAZyme Information: MGYG000002266_00244

Basic Information

• Species: UMGS1864 sp900555835
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1864; UMGS1864 sp900555835
• CAZyme ID: MGYG000002266_00244
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
655	MGYG000002266_3|CGC1	76851.88	9.4961

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002266	1508921	MAG	Peru	South America

• Gene Location: Start: 11924; End: 13891 Strand: +

Full Sequence      

MKLSILTPTYNRAKMLPDLYQSLKDNLKYEVDFEWIIMDDGSTDNTKEVVDGFIKENIMQ
IKYFYQENQGKMVAINKLVEEATGDFMMDCDSDDCFAKNAFGTIKENIDKLVLDQELYAL
IFLKCDVSGEISGEKFKEDNYKTTMFDLYFKDDVKGEKILLFNSRIRKQFKHKIEKGEKF
ITEARMYHEMDKHYKVLCINKPLVIGSYLADGYTKNIKKVFLENPRGYMKYFEEILAFNT
KNILPEKRLYIIKHYILFSYLTKSKNILKPVKNGLDKFLIALLYIPGVIKTKFSFIPKRK
KLLFSSWTLEVGGIETALVNLVNEMSKKYDVTLVLEHKRGPFLDKVKKNIKIIEYTPSTN
KNIFIRKMVNFLKRVKFILKYKYKYDFSVSFATYSRPGSFIARTASKNNLLWVHSNYMII
YKNNIPEIKRFFESVQYDKFKNIVCISEDAKKAFLKVFPNLKNVQVINNIVDYKTILEKA
EEKIDLERADATTFLSVCRHEERAKKLTRLIEAGKLLKDEGYKFRILFVGDGEDTQLYKE
LVEKYDLGKEIIFCGMQANPYPYFKISDCVILTSEYEGYPVIFTEAKLLEKPIITTDVSD
SKIDIKNKYGIVVEKNVESIKNAMEVFIKEGYNIKERFKPEQFNKNIVEKLEKLL

Enzyme Prediction     

No EC number prediction in MGYG000002266_00244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	110	1.2e-22	0.6176470588235294
GT4	488	629	7.1e-19	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03811	GT4_GT28_WabH-like	2.07e-53	301	636	1	333	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03820	GT4_AmsD-like	2.86e-30	300	629	1	321	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
COG0438	RfaB	9.38e-25	298	655	1	378	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd00761	Glyco_tranf_GTA_type	8.94e-24	5	125	1	115	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd03808	GT4_CapM-like	5.54e-23	312	636	10	335	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACV38433.1	5.16e-50	1	243	1	238
ALA96634.1	9.81e-49	1	235	1	233
BAR81106.1	3.35e-48	3	292	4	292
BBM44473.1	3.62e-48	1	243	1	238
BBM36535.1	4.16e-48	1	234	1	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TZE_C	4.45e-08	1	147	1	144	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	6.79e-08	1	147	1	144	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]
3BCV_A	4.58e-07	2	114	6	115	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
2Z87_A	5.86e-06	3	91	94	183	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	5.87e-06	3	91	95	184	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58459	1.94e-14	410	614	115	339	Uncharacterized glycosyltransferase MJ1059 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1059 PE=3 SV=1
Q0P9C6	2.21e-11	2	299	3	294	GalNAc(5)-diNAcBac-PP-undecaprenol beta-1,3-glucosyltransferase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) OX=192222 GN=pglI PE=1 SV=1
P75042	5.02e-10	1	125	1	125	Uncharacterized glycosyltransferase MG060 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) OX=272634 GN=MPN_075 PE=3 SV=1
Q46634	3.14e-09	437	614	130	302	Amylovoran biosynthesis glycosyltransferase AmsD OS=Erwinia amylovora OX=552 GN=amsD PE=3 SV=2
P47306	3.80e-09	1	122	1	121	Uncharacterized glycosyltransferase MG060 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) OX=243273 GN=MG060 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002266_00244.