CAZyme Information: MGYG000002264_00237

Basic Information

• Species: UMGS363 sp900550695
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; UMGS363; UMGS363 sp900550695
• CAZyme ID: MGYG000002264_00237
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	MGYG000002264_4|CGC1	39226.24	5.3176

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002264	2273272	MAG	Peru	South America

• Gene Location: Start: 8979; End: 10007 Strand: -

Full Sequence      

MKRFISIVCAVSIAFSMTACAAKTDVAIQSEATTTASSAKTDKLTLSNPDATKEAVKLFD
YINSIYGKNILSGQQESTWMGSDQYEFDYIEKNTGKLPAIRGLDYMNDDFDGVNKRAKAW
HDKGGIVTICWHCGSDFSGSWSESMKTEIKDWDKALTKGTPEYEKLIKGMDKGAEALKKL
KEQNIPVLWRPFHEFDGAWFWWGKGGSENFKKLWQLMYDRYTNYWELDNLIWVLGYSSNG
KDYDKWYPGDEYVDIAGADSYNDGANEKLYEKTVKVVGEKRPVAFHECGKIPTVDELKKA
NAKWVWFMTWHTEYITDHNDTKTLKDIYNSDYVITLDELPKL

Enzyme Prediction     

No EC number prediction in MGYG000002264_00237.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	47	338	9.9e-97	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	7.38e-59	48	338	2	311	Glycosyl hydrolase family 26.
COG4124	ManB2	2.87e-19	140	289	139	296	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU20874.1	4.64e-129	46	340	167	460
BCN30282.1	4.11e-122	43	341	3	298
AWB26443.1	3.40e-84	45	342	47	339
AJP70762.1	2.87e-82	46	339	22	318
AOW25662.1	3.71e-81	54	339	9	294

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	1.17e-63	48	339	25	327	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3ZM8_A	5.71e-63	46	339	145	447	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HF2_A	1.04e-52	43	330	42	330	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6HPF_A	2.46e-49	48	339	8	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	2.80e-48	49	340	37	353	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	2.00e-61	46	339	174	476	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P55298	1.65e-51	45	340	155	460	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1
P55297	2.38e-51	45	340	157	462	Mannan endo-1,4-beta-mannosidase B OS=Piromyces sp. OX=45796 GN=MANB PE=2 SV=1
P49425	3.84e-49	46	340	146	458	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55296	5.53e-48	45	340	156	461	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000058	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002264_00237.