CAZyme Information: MGYG000002257_01118

Basic Information

• Species: UBA737 sp900547305
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737; UBA737 sp900547305
• CAZyme ID: MGYG000002257_01118
• CAZy Family: GH136
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
303	MGYG000002257_32|CGC2	32922.43	4.6607

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002257	2338223	MAG	Peru	South America

• Gene Location: Start: 21839; End: 22750 Strand: -

Full Sequence      

MASDYEHGPGVEWSAFEYTPSTNATFRNNFVSQCASDGIFISAVKGLLIESNTVTDTSYA
EGAYAGIWPHYSSNVVMQYNEAYDIKLVGGDGQGYDVDIDCVNTKVQYNYSHDNEGGFIL
LCTDGSNGGYNKDISVRYNISQNDKSQIFTLSGPISDVKIYNNTVYTKAGLKTNLVGSYD
WGTAASPKNVRFTNNIFNMNSTGWCSLIIPSRITFDTNLFYGTYGFAQLFQSGVKISGSR
TEDPMFVNPGAGGIGLDTLGGYRLKSSSPAINSGKWISQCGGRDFYGKAVTKEGLPDLGA
IEY

Enzyme Prediction     

No EC number prediction in MGYG000002257_01118.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH136	15	302	2.7e-71	0.5723014256619144

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	3.20e-06	21	127	54	150	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.28e-04	14	166	1	135	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam17161	DUF5123	0.004	160	252	3	97	Domain of unknown function (DUF5123).
cd14251	PL-6	0.009	157	223	303	369	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDS99205.1	2.22e-55	18	303	230	510
SMF84525.1	1.08e-54	5	303	234	521
AIQ58808.1	1.44e-54	10	302	220	506
AIQ30071.1	9.31e-54	10	302	220	506
QGQ95108.1	1.74e-52	18	300	241	510

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V6M_A	1.88e-24	21	302	258	576	ChainA, Fibronectin type III domain-containing protein [Tyzzerella nexilis]
5GQC_A	3.00e-23	21	302	296	596	Crystalstructure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_C Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_D Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_E Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_F Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_G Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQC_H Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, ligand-free form [Bifidobacterium longum subsp. longum],5GQF_A Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, lacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQF_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, lacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQG_A Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, galacto-N-biose complex [Bifidobacterium longum subsp. longum],5GQG_B Crystal structure of lacto-N-biosidase LnbX from Bifidobacterium longum subsp. longum, galacto-N-biose complex [Bifidobacterium longum subsp. longum]
7V6I_A	5.16e-21	3	302	281	608	ChainA, Lacto-N-biosidase [Bifidobacterium saguini DSM 23967]
6KQT_A	1.84e-11	16	169	483	641	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - native protein [Eubacterium ramulus ATCC 29099]
6KQS_A	1.90e-10	16	169	483	641	CrystalStructure of GH136 lacto-N-biosidase from Eubacterium ramulus - selenomethionine derivative [Eubacterium ramulus ATCC 29099]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000018	0.000038	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002257_01118.