CAZyme Information: MGYG000002256_00696

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3282
• CAZyme ID: MGYG000002256_00696
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469	MGYG000002256_12|CGC1	51421.38	4.2492

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002256	2755304	MAG	Peru	South America

• Gene Location: Start: 13874; End: 15283 Strand: +

Full Sequence      

MEKPHLKSTETPSVPTFETNPEPASQTQPAAAPTPEQSPEPAADSAPVSSQPAVSPAQTG
ASTGRLQIDVTASIGLIPIPGATIRISFTGEPDSMVETLTTDSSGQTETVSLEAPPLQYS
LTPDSPMPYAEYTVSVTAPGYEPVIVSGVEVLPDVTAIQQIRMTPSETTTEDLERISIPD
HTLYGDYPPKIPEDEIKPMDETGEIVLSRVVIPEYIIVHDGVPSDSSAPNYYVKYRDYIK
NVVSSEIYATWPESTIYANTLAIMSFTLNRVYTEWYRNQGYNFTITSSTAYDQKWIRGRN
IYTNIDRLVDTIFANYLSRPGVRQPIFTSYCDGRTTTCSGLSQWGSKYLGDEGYSAIEII
RYYYGSDMYINTAVAVSGVPSSWPGYNLGIGASGQKVLQIQQQLNRIAQNYPAIPKITAD
GIYGSSTANAVRTFQRIFNLGQTGIVDYPTWYEISEIFVGVSRISEPGT

Enzyme Prediction     

No EC number prediction in MGYG000002256_00696.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	7.86e-13	393	451	1	54	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
pfam13620	CarboxypepD_reg	4.46e-07	78	163	13	81	Carboxypeptidase regulatory-like domain.
COG3409	PGRP	1.56e-06	390	451	41	99	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
TIGR02669	SpoIID_LytB	2.38e-05	227	364	106	260	SpoIID/LytB domain. This model describes a domain found typically in two or three proteins per genome in Cyanobacteria and Firmicutes, and sporadically in other genomes. One member is SpoIID of Bacillus subtilis. Another in B. subtilis is the C-terminal half of LytB, encoded immediately upstream of an amidase, the autolysin LytC, to which its N-terminus is homologous. Gene neighborhoods are not well conserved for members of this family, as many, such as SpoIID, are monocistronic. One early modelling-based study suggests a DNA-binding role for SpoIID, but the function of this domain is unknown. [Unknown function, General]
COG3409	PGRP	3.42e-05	384	454	117	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT50293.1	5.78e-193	57	466	6	417
QJU14725.1	1.67e-190	64	466	17	419
QQQ92685.1	1.67e-190	64	466	17	419
ASU27931.1	1.67e-190	64	466	17	419
QEI32542.1	2.31e-190	53	466	13	428

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002256_00696.