CAZyme Information: MGYG000002254_00555

Basic Information

• Species: CAG-110 sp900556935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; CAG-110; CAG-110 sp900556935
• CAZyme ID: MGYG000002254_00555
• CAZy Family: GH5
• CAZyme Description: Endoglucanase 5A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000002254_18|CGC1	39754.62	4.4637

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002254	2358769	MAG	Peru	South America

• Gene Location: Start: 19971; End: 21023 Strand: -

Full Sequence      

MFKKRTVKTLACIGVAAAALVFWQQKQLQNRLETENQALRQELEDLMTQKGGIEEHGRLR
VNGTQLVDQTGAPLQLRGVSSHGITWYPEYTNYAALKTLKDYGANVFRIALYVEQNDGYL
EEPELGKKLLFSAIENSLAADLYTVVDWHVLRDENPNRNVEKALAVLEEVAQRYGDEPGI
LYEICNEPNGDTTYEDIVRYADQIIPVIRQHAPNALILVGTPNFCTSLSEAIQNPLEYPN
VMYTYHYYAGISDCKSAMKKIARGLSAGLPVFVSEWGLDSQDASEEHWNETRVFLDYLEQ
EQIGWINWSLCNKDEGYSILLPDSHKLHGWTGEDFTDSGKFLLDYLENSE

Enzyme Prediction     

EC	3.2.1.4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	70	307	4.2e-70	0.9915611814345991

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	8.80e-56	67	314	1	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	5.51e-07	57	321	45	374	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJA08944.1	6.73e-100	50	348	42	340
QQR30621.1	6.89e-79	48	344	221	517
ANU55408.1	6.89e-79	48	344	221	517
ASB41357.1	6.89e-79	48	344	221	517
BCV18962.1	1.52e-78	57	346	66	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GJF_A	6.65e-84	53	349	7	303	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
1A3H_A	4.52e-78	53	349	3	300	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]
1H11_A	4.96e-78	53	349	6	303	2-DEOXY-2-FLURO-B-D-CELLOTRIOSYL/ENZYMEINTERMEDIATE COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION [Salipaludibacillus agaradhaerens],1H2J_A ENDOGLUCANASE CEL5A IN COMPLEX WITH UNHYDROLYSED AND COVALENTLY LINKED 2,4-DINITROPHENYL-2-DEOXY-2-FLUORO-CELLOBIOSIDE AT 1.15 A RESOLUTION [Salipaludibacillus agaradhaerens],1HF6_A ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHAERENS IN THE ORTHORHOMBIC CRYSTAL FORM IN COMPLEX WITH CELLOTRIOSE [Salipaludibacillus agaradhaerens],1OCQ_A COMPLEX OF THE ENDOGLUCANASE CEL5A FROM BACILLUS AGARADHEARANS AT 1.08 ANGSTROM RESOLUTION with cellobio-derived isofagomine [Salipaludibacillus agaradhaerens],1W3K_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellobio Derived-tetrahydrooxazine [Salipaludibacillus agaradhaerens],1W3L_A Endoglucanase Cel5a From Bacillus Agaradhaerens In Complex With Cellotri Derived-Tetrahydrooxazine [Salipaludibacillus agaradhaerens],4A3H_A 2',4' Dinitrophenyl-2-Deoxy-2-Fluro-B-D-Cellobioside Complex Of The Endoglucanase Cel5a From Bacillus Agaradhaerens At 1.6 A Resolution [Salipaludibacillus agaradhaerens],5A3H_A 2-Deoxy-2-Fluro-B-D-CellobiosylENZYME INTERMEDIATE COMPLEX Of The Endoglucanase Cel5a From Bacillus Agaradhearans At 1.8 Angstroms Resolution [Salipaludibacillus agaradhaerens],6A3H_A 2-Deoxy-2-Fluro-B-D-CellotriosylENZYME INTERMEDIATE COMPLEX OF THE Endoglucanase Cel5a From Bacillus Agaradhearans At 1.6 Angstrom Resolution [Salipaludibacillus agaradhaerens],7A3H_A Native Endoglucanase Cel5a Catalytic Core Domain At 0.95 Angstroms Resolution [Salipaludibacillus agaradhaerens],8A3H_A Cellobiose-derived imidazole complex of the endoglucanase cel5A from Bacillus agaradhaerens at 0.97 A resolution [Salipaludibacillus agaradhaerens]
1H5V_A	5.12e-78	53	349	6	303	Thiopentasaccharidecomplex of the endoglucanase Cel5A from Bacillus agaradharens at 1.1 A resolution in the tetragonal crystal form [Salipaludibacillus agaradhaerens]
1E5J_A	5.28e-78	53	349	6	303	EndoglucanaseCel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Methyl-4ii-S-Alpha-Cellobiosyl-4ii-Thio Beta-Cellobioside [Salipaludibacillus agaradhaerens],1QHZ_A Native Tetragonal Structure Of The Endoglucanase Cel5a From Bacillus Agaradhaerens [Salipaludibacillus agaradhaerens],1QI0_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With Cellobiose [Salipaludibacillus agaradhaerens],1QI2_A Endoglucanase Cel5a From Bacillus Agaradhaerens In The Tetragonal Crystal Form In Complex With 2',4'-Dinitrophenyl 2-Deoxy-2-Fluoro-B- D-Cellotrioside [Salipaludibacillus agaradhaerens],2V38_A Family 5 endoglucanase Cel5A from Bacillus agaradhaerens in complex with cellobio-derived noeuromycin [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15704	8.17e-77	57	349	45	338	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
O85465	4.82e-76	53	349	32	329	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P06565	1.24e-75	53	349	32	329	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
P22541	1.20e-74	53	346	110	407	Endoglucanase A OS=Butyrivibrio fibrisolvens OX=831 GN=celA PE=1 SV=1
P07983	4.05e-73	50	350	33	333	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.963716	0.016783	0.016735	0.000133	0.000075	0.002563

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002254_00555.