CAZyme Information: MGYG000002243_00431

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Oribacterium
• CAZyme ID: MGYG000002243_00431
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
398	MGYG000002243_47|CGC1	43239.68	6.3615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002243	1897740	MAG	Peru	South America

• Gene Location: Start: 6294; End: 7490 Strand: +

Full Sequence      

MLIVSNSKNDASHGTAQSMLYNKERNCADQKAGLTVFPSIQAAVDAADAACKKALQCGEI
WTGETILISKGVYHERVTITTPGLTLLGEGATETIISYGLYGFMPSPDIGKLGTFRSYTM
LIDADRVTLRDLGIENTAGAGPDIGQAIALYADGDELCFDHIALLGWQDTLFTGPLPPKE
IEKNGFIGPKQFAPRRNGRQYYHDCHIEGDIDFIFGSATAYFDHCTIYQKDRRKLLRPAD
TGPVPRKPSCNDASLPGSAESPGTKRASAADPHAVGEALSYATAASTAEGQRYGYVFDHC
RFLSDCPAGSCYLGRPWRNFARVAILHSWLGPQIHPSGFHNWGKAEAEGSVVFCEYQNEG
PGAAHAQRARFVKELSDEEATEYTCEKVVPFAVKKGKV

Enzyme Prediction     

No EC number prediction in MGYG000002243_00431.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	31	230	1.5e-47	0.5694444444444444
CE8	278	388	1.1e-28	0.3854166666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	7.27e-61	66	384	115	397	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	2.03e-47	66	384	32	290	Pectinesterase.
PLN02773	PLN02773	5.98e-42	66	383	37	290	pectinesterase
PLN02682	PLN02682	2.62e-40	66	380	102	352	pectinesterase family protein
PLN02990	PLN02990	3.56e-39	66	384	291	549	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABX41678.1	9.91e-100	65	389	36	331
SET76962.1	3.34e-97	64	389	30	313
CBL11054.1	1.71e-95	66	389	34	360
QIX89293.1	2.92e-95	66	389	47	340
VCV23720.1	6.84e-95	66	389	34	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	1.42e-24	62	371	31	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	1.53e-24	66	389	37	334	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
3UW0_A	3.06e-22	66	390	63	359	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
5C1C_A	5.88e-22	58	368	30	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	5.88e-22	58	368	30	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	1.09e-35	66	383	37	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	2.60e-34	66	384	288	546	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9FJ21	2.13e-32	66	384	290	548	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
O23447	3.81e-30	66	383	422	679	Putative pectinesterase/pectinesterase inhibitor 43 OS=Arabidopsis thaliana OX=3702 GN=PME43 PE=2 SV=1
Q8VYZ3	2.44e-29	66	383	116	369	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999980	0.000080	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002243_00431.