CAZyme Information: MGYG000002241_00134

Basic Information

• Species: UMGS1901 sp900556135
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; UMGS1901; UMGS1901 sp900556135
• CAZyme ID: MGYG000002241_00134
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
868	MGYG000002241_1|CGC5	95280.31	7.0582

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002241	1320271	MAG	Peru	South America

• Gene Location: Start: 145054; End: 147660 Strand: +

Full Sequence      

MGNTNKKKSSAKKAKNVKRKDLDKEIGKNKKKGFWKRHPKFKKTIRILIILFILLIIVGA
GIIAGIFFSDKWEISEENLTLSKINTTVYDKDGNEIATVSGDEKRKVVHLSDIPQQLQDA
FVSIEDKTFYTHHGVNLKRTVGATLTYAINRGKGSSYGGSTITQQLVKNLMNDKDDSGMA
GVQRKIREISRAYQVEKILSKDQILELYLNLIFMGGDVYGVELGSQYYFNKSCNELDLAQ
CAFLAGINHSPNSYNPFTETDNSEKIKKRTKTVLGEMKSLGKITEEEYNSAVAEVDTGLA
FERGTTTSAATMSYLAKAALNQVVKQYAEEKDLDVDYATTKIYGGGYRIYTTQDNSIQTI
MENLYKDNDYIYSGRQKDKDGNLINKHVQSAMVVIDHKTGQVVGCIGGMGDDVDSNGLNR
ATQSPRQPGSSIKPIASIAPALEKGIITAGTVYDESNTYFGNYNPTNSHKGLITVRKAIE
ISANTTEVKIMSELGPKNSIDFMRQMGITSLVTASENSSHNDENLALVLGGVTNGISALE
MAGAYATIANGGVYITPTFYTKMTDASGNVILEPVQEKNRVMSEGNSYIARSILTGPVGS
GGTAPYCKISGQETGGKTGTTTDNKDRWFCGFTSYYTAATWFGYDQPEYISSSTNPAARL
WAYAMKKIHADLADSSFEKPSNIVSATICKDSGKVATSSCTNTYTEYYVKGTVPDECDGH
KVLTICTDTGKIANEFCPNTEEKSYTSRPEKEDTTLWKTDGSDKYDVPTEVCTEHTKKTI
KMINVVGLSKDDAISKIKALGLKVTVETKESDKKEGTVLSQSKQEGAELSADETITIVVS
KKKTTSDNDDKKNEIKENKENVNEVVED

Enzyme Prediction     

No EC number prediction in MGYG000002241_00134.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	92	278	6.8e-59	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02074	PBP_1a_fam	5.05e-160	104	671	1	531	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	2.17e-155	83	716	53	635	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.90e-125	58	716	18	766	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	3.64e-81	88	749	39	638	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	4.40e-70	92	278	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNU66566.1	2.39e-136	44	720	31	719
QCX34227.1	3.09e-135	83	720	61	710
AEV70266.1	6.92e-134	45	720	30	705
AUS97464.1	4.46e-130	40	720	25	733
ADU75447.1	8.67e-130	73	720	63	709

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7U4H_A	5.97e-88	85	714	20	807	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
3ZG8_B	1.29e-64	194	648	2	436	CrystalStructure of Penicillin Binding Protein 4 from Listeria monocytogenes in the Ampicillin bound form [Listeria monocytogenes],3ZG9_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Cefuroxime bound form [Listeria monocytogenes],3ZGA_B Crystal Structure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the Carbenicillin bound form [Listeria monocytogenes]
3ZG7_B	5.14e-61	194	648	2	436	CrystalStructure of Penicillin-Binding Protein 4 from Listeria monocytogenes in the apo form [Listeria monocytogenes]
4OON_A	1.48e-55	83	714	18	768	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	1.06e-54	84	683	6	602	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7GHV1	1.78e-111	26	718	1	699	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) OX=441772 GN=pbpA PE=3 SV=1
A5I6G4	1.41e-110	26	718	1	699	Penicillin-binding protein 1A OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=pbpA PE=3 SV=1
A7FY32	1.41e-110	26	718	1	699	Penicillin-binding protein 1A OS=Clostridium botulinum (strain ATCC 19397 / Type A) OX=441770 GN=pbpA PE=3 SV=1
Q97GR5	7.62e-104	41	719	29	700	Penicillin-binding protein 1A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) OX=272562 GN=pbpA PE=3 SV=1
Q891X1	9.57e-104	86	720	61	713	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999921	0.000106	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
47	69