CAZyme Information: MGYG000002236_01338

Basic Information

• Species: UBA6984 sp900550295
• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae; UBA6984; UBA6984 sp900550295
• CAZyme ID: MGYG000002236_01338
• CAZy Family: CE11
• CAZyme Description: UDP-3-O-acyl-N-acetylglucosamine deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	MGYG000002236_28|CGC1	30524.23	7.9922

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002236	1761697	MAG	Peru	South America

• Gene Location: Start: 21889; End: 22704 Strand: -

Full Sequence      

MATIKKELSIKGNTLMKNHECNVLIKPSTSGKIKFYLDGYDDAIVADVDNVSSTSHCVCI
GSGNRQVMLIEHFMAACAFCNIDSIDVYIDKPEMPVLDGSSYEWVKAFKKVGIEKSKPVY
YTLLEPVSYLNGKTHVVIIPDEELRISYGVNYDHPDMKNRWASFTVKNQNEIIEARTFGF
LHDLKKFQFFGYAKGVTQENTVGFTDDGGYTTKLRSDREPIKHKILDIIGDLYLTGVNPL
HLKAQIIAKEAGHAVHVKTALKLKNKLIRCE

Enzyme Prediction     

No EC number prediction in MGYG000002236_01338.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	2	263	4.2e-67	0.985239852398524

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03331	LpxC	4.32e-76	3	263	3	269	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
PRK13186	lpxC	6.45e-72	3	263	6	272	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
COG0774	LpxC	1.20e-56	3	258	6	270	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
PRK13188	PRK13188	9.59e-48	3	269	7	304	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed
TIGR00325	lpxC	6.83e-43	3	263	5	271	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR38878.1	9.73e-107	1	268	36	307
BAY46134.1	3.42e-40	3	263	5	278
BAZ25618.1	4.93e-40	3	263	5	278
AYV54494.1	5.07e-40	3	260	9	271
BAQ63877.1	6.52e-40	10	269	7	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IH0_A	6.32e-30	3	271	6	273	Aquifexaeolicus LpxC complex with ACHN-975 [Aquifex aeolicus VF5]
1P42_A	2.00e-29	3	269	5	270	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1P42_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YH8_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YH8_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YHC_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],1YHC_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus]
2IER_A	2.04e-29	3	269	6	271	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IER_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IES_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2IES_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2J65_A Structure of LpxC from Aquifex aeolicus in complex with UDP [Aquifex aeolicus VF5],2J65_B Structure of LpxC from Aquifex aeolicus in complex with UDP [Aquifex aeolicus VF5],2O3Z_A Chain A, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],2O3Z_B Chain B, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],3P76_A X-ray crystal structure of Aquifex aeolicus LpxC complexed SCH1379777 [Aquifex aeolicus],4U3B_A LpxC from A.Aaeolicus in complex with the MMP inhibitor 4-[[4-(4-chlorophenoxy)phenyl]sulfanylmethyl]tetrahydropyran-4-carbohydroxamic acid - compound 2 [Aquifex aeolicus VF5],4U3D_A LpxC from A.Aaeolicus in complex with 4-[[4-[2-[4-(morpholinomethyl)phenyl]ethynyl]phenoxy]methyl]tetrahydropyran-4-carbohydroxamic acid (compound 9) [Aquifex aeolicus VF5]
2JT2_A	2.17e-29	3	269	6	271	ChainA, UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase [Aquifex aeolicus],5DRO_A Structure of the Aquifex aeolicus LpxC/LPC-011 Complex [Aquifex aeolicus VF5],5DRO_B Structure of the Aquifex aeolicus LpxC/LPC-011 Complex [Aquifex aeolicus VF5],5DRP_A Structure of the AaLpxC/LPC-023 Complex [Aquifex aeolicus VF5],5DRP_B Structure of the AaLpxC/LPC-023 Complex [Aquifex aeolicus VF5]
3P3C_A	2.17e-29	3	269	5	270	CrystalStructure of the Aquifex aeolicus LpxC/LPC-009 complex [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3MH15	1.68e-40	3	263	5	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=lpxC PE=3 SV=1
Q72RV5	2.00e-40	3	260	9	271	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) OX=267671 GN=lpxC PE=3 SV=2
Q8F3U4	2.00e-40	3	260	9	271	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) OX=189518 GN=lpxC PE=3 SV=1
Q8YUR5	9.25e-40	3	263	5	275	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=lpxC PE=3 SV=1
Q051J2	1.10e-39	3	260	9	271	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) OX=355276 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000013	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002236_01338.