CAZyme Information: MGYG000002230_00740

Basic Information

• Species: Ruminococcus sp900545125
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus; Ruminococcus sp900545125
• CAZyme ID: MGYG000002230_00740
• CAZy Family: GH48
• CAZyme Description: Cellulose 1,4-beta-cellobiosidase (reducing end) CelS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	MGYG000002230_37|CGC1	91616.06	4.2102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002230	2337720	MAG	United States	North America

• Gene Location: Start: 2002; End: 4491 Strand: +

Full Sequence      

MISKKNKALVAGILAAATSVSAVMPALGSAAETTEYAKENGANESYAAMFSSLYDDVITN
GQQNGYLSSQNNGGDSFGIPYHAIETVVVEAPDYGHETTSEAMSYVAWVTAMHDVLVQNG
KIDGQTGDLEKGWKTLEAIIPGWSEASGINNSIKYSSLWSQQRLKADTAKELDLPEQYPT
SNAGVDAINPLFNEFKSTYGGDNGYYLMHWLADVDDWYGFGGGKDNFTFINTFQRGEQES
CFETVPHPCIEELKYGNTQDGIKGIFNGVGNVSAQYAFTNAPDAEDRAIQAIYFANQWGV
DCGDLSGLAGKMGDQCRNDMFDKYYHEIGCQDIMSSGSAGTKSQHYLMAWYTSWGGALGN
YDWAWQIGCSHSHQFYQNPLAAYALVTDQWMNSGMASGSQATSDYKESLKRQIEMYLWLQ
SVEGPFAGGCTNSYRGRYEKYPDGYPTFYDMVYVPHPVYADPGSNHWIGNQVWSTQRLAE
LYYYVSKNGDNSGVKPAGMSIEDALDALLERWITWFEENTKFDYVTEDGTFMSYAIPSNL
DWGDSDTDYTVAPDTWTGKYDPNGNQKLHCTITSYGQGDIGCVSSLCNTLIYYAAAKGVP
SSEAYEATAKDDSVAAKGLRLANKLLSAQWNQGRDEVGIAFTDHNGSLKRVFEQEVYIPT
NYTGKMPDGSKLENGATFISIRESYHDDPMFQELEKVYNETGATDAFEFKLHRFWHMGDA
LMAYGGMALLYPDVTPINEDEPDTDILWGDADCDGKVYLNDAVLVMQAVGSPDVYGENGS
DPSHITTQGIKNADVYENGTLLTNNDALQIQKYLLNLVTSLDPKDFVKE

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH48	46	728	1.2e-211	0.9950900163666121

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02011	Glyco_hydro_48	0.0	46	731	1	620	Glycosyl hydrolase family 48. Members of this family are endoglucanase EC:3.2.1.4 and exoglucanase EC:3.2.1.91 enzymes that cleave cellulose or related substrate.
cd14256	Dockerin_I	2.13e-05	749	815	2	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADX05724.1	0.0	1	772	1	806
CBL17316.1	7.69e-302	1	818	1	797
ADU23081.1	8.23e-262	1	734	1	779
BAJ05814.1	8.23e-262	1	734	1	779
CAS03459.1	2.70e-259	1	744	1	790

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1L1Y_A	1.08e-174	13	735	10	665	ChainA, cellobiohydrolase [Acetivibrio thermocellus],1L1Y_B Chain B, cellobiohydrolase [Acetivibrio thermocellus],1L1Y_C Chain C, cellobiohydrolase [Acetivibrio thermocellus],1L1Y_D Chain D, cellobiohydrolase [Acetivibrio thermocellus],1L1Y_E Chain E, cellobiohydrolase [Acetivibrio thermocellus],1L1Y_F Chain F, cellobiohydrolase [Acetivibrio thermocellus],1L2A_A Chain A, cellobiohydrolase [Acetivibrio thermocellus],1L2A_B Chain B, cellobiohydrolase [Acetivibrio thermocellus],1L2A_C Chain C, cellobiohydrolase [Acetivibrio thermocellus],1L2A_D Chain D, cellobiohydrolase [Acetivibrio thermocellus],1L2A_E Chain E, cellobiohydrolase [Acetivibrio thermocellus],1L2A_F Chain F, cellobiohydrolase [Acetivibrio thermocellus]
6D5D_A	3.33e-173	64	731	36	642	Structureof Caldicellulosiruptor danielii GH48 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
5YJ6_A	4.60e-173	45	733	12	636	ChainA, Dockerin type I repeat-containing protein [Acetivibrio thermocellus DSM 1313]
4EL8_A	1.30e-169	64	731	25	631	Theunliganded structure of C.bescii CelA GH48 module [Caldicellulosiruptor bescii DSM 6725]
4L0G_A	2.63e-169	64	731	29	635	CrystalStructure of a GH48 cellobiohydrolase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii DSM 6725],4L6X_A Crystal Structure of a GH48 cellobiohydrolase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii DSM 6725],4TXT_A Crystal Structure of a GH48 cellobiohydrolase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3DH67	4.93e-178	13	769	10	698	Cellulose 1,4-beta-cellobiosidase (reducing end) CelS OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celS PE=1 SV=1
P0C2S5	4.93e-178	13	769	10	698	Cellulose 1,4-beta-cellobiosidase (reducing end) CelS OS=Acetivibrio thermocellus OX=1515 GN=celS PE=1 SV=1
P50900	8.70e-165	23	731	20	655	Exoglucanase-2 OS=Thermoclostridium stercorarium (strain ATCC 35414 / DSM 8532 / NCIMB 11754) OX=1121335 GN=celY PE=1 SV=2
P37698	2.44e-163	2	741	1	672	Endoglucanase F OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCF PE=1 SV=2
P22534	3.05e-160	78	731	1140	1739	Endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000233	0.999065	0.000167	0.000196	0.000173	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002230_00740.