CAZyme Information: MGYG000002228_02127

Basic Information

• Species: UBA1691 sp900544715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1691; UBA1691 sp900544715
• CAZyme ID: MGYG000002228_02127
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391	MGYG000002228_14|CGC2	45189.89	4.804

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002228	2797749	MAG	United States	North America

• Gene Location: Start: 65361; End: 66536 Strand: +

Full Sequence      

MLRRIFSMLMAVISCILSLVGWNGMIQVEDAHYEMVDQALINPNADESAKALYRFLLDCY
GKRVISGQYINEYEYFSAPQFRVDENDPNSPMTVFKANELQAVHSVTNAYPAMIGLDLSE
TETGRKCYSVQQAIEWHQAGGIVTFCWHWMAPSQTEGKRHFYTEQTDFNLKQALDNPNSP
EYQGLLRDIDIISKEMKKLQDAGVPVLWRPLHEASGGWFWWGASGAEAYKELWNLMYDRM
TNVNGLNNLIWVYNGQNPRWYVGDDKCDIIGDDPYYTNSSRILYRFNQANANRFKTCYKT
SQNKMIAMTENDFVPNIDRMFEKGTKWLTFCTWCREFVCVIDESTAWGATTPEYSEKYAT
AKELREAYQDERVITLDQLRADGGYSQAGDR

Enzyme Prediction     

EC	3.2.1.78	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	42	378	1.4e-95	0.9933993399339934

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	9.20e-56	41	333	1	282	Glycosyl hydrolase family 26.
COG4124	ManB2	6.59e-15	196	319	164	309	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASA25926.1	1.19e-92	30	379	6	333
AIQ56350.1	3.56e-89	29	379	4	334
ANY72642.1	1.42e-87	25	379	1	333
ADZ83356.1	5.68e-86	36	381	160	482
QEH68821.1	6.65e-86	36	381	169	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZM8_A	1.43e-65	36	380	141	448	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	1.22e-57	101	379	42	310	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	5.71e-46	36	379	30	352	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6HF2_A	4.44e-43	29	333	34	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]
6D2X_A	7.14e-36	40	336	4	311	Crystalstructure of the GH26 domain from PbGH26-GH5A endo-beta-mannanase/endo-beta-glucanase from Prevotella bryantii [Prevotella bryantii B14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	7.05e-64	36	380	170	477	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
P49425	3.41e-57	40	379	146	457	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
Q5AWB7	8.00e-52	111	380	74	351	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
A2R6F5	2.13e-49	41	377	29	331	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	1.23e-42	36	379	153	460	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.732107	0.116334	0.148953	0.000420	0.000277	0.001919

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002228_02127.