CAZyme Information: MGYG000002223_00107

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium
• CAZyme ID: MGYG000002223_00107
• CAZy Family: CE6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000002223_5|CGC1	26946.75	4.978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002223	1981557	MAG	Peru	South America

• Gene Location: Start: 7360; End: 8100 Strand: -

Full Sequence      

MALWINDGLREAAQGIRSFLLVGQSNMAGRGDLTPENTITAPDCFMLRMGRWQPMSEPIN
VDRAVAEGAVPRSGANLAASFAAQLQKETEAKIGLIPCADGGTRISQWQPGEVLFDHAVF
QAKLAMRTSALTAILWHQGESDCLAPEQLEAYPEQFLRTMRAFREELGDLPIVVGELGYP
ENGFHGTPAEQLKEFNHRLPELAAQLPKCAVVSAADLTARPDGLHFTTESLRTLGLRYLE
AYKSLV

Enzyme Prediction     

No EC number prediction in MGYG000002223_00107.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE6	77	167	1.8e-24	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03629	SASA	9.92e-69	19	242	5	224	Carbohydrate esterase, sialic acid-specific acetylesterase. The catalytic triad of this esterase enzyme comprises residues Ser127, His403 and Asp391 in UniProtKB:P70665.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD0220167.1	6.34e-61	16	245	2	227
QXU50969.1	1.02e-59	16	245	2	227
QQV01830.1	3.36e-57	16	242	2	224
QRY56403.1	3.20e-55	16	242	2	224
QQT56222.1	6.40e-55	16	242	2	224

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ZMB_A	6.59e-49	16	242	2	224	CrystalStructure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_B Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_C Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_D Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_E Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824],1ZMB_F Crystal Structure of the Putative Acetylxylan Esterase from Clostridium acetobutylicum, Northeast Structural Genomics Target CaR6 [Clostridium acetobutylicum ATCC 824]
2APJ_A	5.03e-27	19	244	25	257	X-RayStructure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_B X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_C X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana],2APJ_D X-Ray Structure of Protein from Arabidopsis Thaliana AT4G34215 at 1.6 Angstrom Resolution [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8L9J9	5.14e-27	19	244	25	257	Probable carbohydrate esterase At4g34215 OS=Arabidopsis thaliana OX=3702 GN=At4g34215 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002223_00107.