CAZyme Information: MGYG000002219_01520

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Kiritimatiellae; RFP12; UBA1067; UBA1731
• CAZyme ID: MGYG000002219_01520
• CAZy Family: GT2
• CAZyme Description: Dodecaprenyl-phosphate galacturonate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246	MGYG000002219_425|CGC1	27888.36	9.8395

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002219	2429287	MAG	Peru	South America

• Gene Location: Start: 1612; End: 2352 Strand: +

Full Sequence      

MTIALVIPCKNEYWRLDISAFLDAIRAFPWLTLLFVDDGSTDDTAETLAFLSRQSPAIQA
IYLPRNVGKAAAVHAGVQTLLTRTQADWIGFWDADLATPLSELKAFHDELERHPDAQAIL
GARWPHLGAQIDRTLFRNAAATLMKALIRHLLHAPVYDTQCGAKIFRRDLAKRIFAEPFR
SKWLFDVELLRRIPLRTMRHAVIEHPLSVWHDVPGSKLKLADSARVFLDLLRMSMSRSQI
TKSGQT

Enzyme Prediction     

No EC number prediction in MGYG000002219_01520.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	174	7.9e-19	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04188	DPG_synthase	2.31e-52	5	217	1	211	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
cd04179	DPM_DPG-synthase_like	8.20e-38	5	190	1	182	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
PTZ00260	PTZ00260	6.60e-27	3	235	72	314	dolichyl-phosphate beta-glucosyltransferase; Provisional
cd04187	DPM1_like_bac	3.65e-20	5	180	1	170	Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily.
pfam00535	Glycos_transf_2	1.36e-16	6	170	3	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM46779.1	1.07e-63	3	233	4	238
BAH37906.1	6.86e-57	3	238	4	249
BCS36393.1	5.55e-54	1	233	2	242
QRM88719.1	1.28e-53	1	233	1	237
ARK10267.1	6.09e-53	3	240	5	246

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2EK20	2.70e-22	6	235	78	312	Dolichyl-phosphate beta-glucosyltransferase ALG5B OS=Trichomonas vaginalis OX=5722 GN=ALG5B PE=1 SV=1
A2DSR8	6.28e-21	6	235	78	309	Dolichyl-phosphate beta-glucosyltransferase ALG5E OS=Trichomonas vaginalis OX=5722 GN=ALG5E PE=1 SV=1
A2ELE6	1.39e-20	6	235	81	315	Dolichyl-phosphate beta-glucosyltransferase ALG5C OS=Trichomonas vaginalis OX=5722 GN=ALG5C PE=1 SV=1
A2E3C6	3.25e-20	3	235	76	313	Dolichyl-phosphate beta-glucosyltransferase ALG5D OS=Trichomonas vaginalis OX=5722 GN=ALG5D PE=1 SV=1
A2DZE8	5.92e-20	3	235	75	309	Dolichyl-phosphate beta-glucosyltransferase ALG5A OS=Trichomonas vaginalis OX=5722 GN=ALG5A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002219_01520.