CAZyme Information: MGYG000002218_01200

Basic Information

• Species: Parabacteroides sp000436495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp000436495
• CAZyme ID: MGYG000002218_01200
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
886	MGYG000002218_8|CGC2	100266.03	5.217

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002218	3613635	MAG	Spain	Europe

• Gene Location: Start: 120119; End: 122779 Strand: +

Full Sequence      

MKTSIIYWVSAFLLTVLGACSSRPSLVVKELQCEKLVNPLAIDQTKPYLSWQLETNENAV
HQSAYQILAATDEHLLTEEKADLWNSGKVESPESAWVLYQGNELTSKQFVYWKVRVWDGD
DKASDWSETACFGIGLLHPSDWKAAYIGSDTLSGKPQSPLLWKHFQWNQKGTKAFLHVNS
LGYHEVYLNGKKVGDAVLAPAVSQFDKRSLSVTYDVTDLLEKGENDFVLWLGKGWYQDGL
PGVVNGGPFVRAQLEEFENGEWRTSLITDSTWKTRESGYASTGTWRPWQFGGEEISADRL
LPALDRKTLNSVDWNTAVLAAIPEHQVSPQMAELNGIREHLHPLTCKASGDSAWIYDLGT
NLTGWTKIQFPPLEKGQKIRISYCDFLDDKGEFRDHLYEDYYIASGADSAEVFSNKFNYH
AYRYLKLTNLKEAPALSAITASLVHTNYSGESFFACSDKDLNAIHDMIHYTLRCLTLGGY
MVDCPQIERLGYGGDGNASTPTVQTMFNLSPLYMNWMQAWADCMREDGSMPHTAPNPYAA
GGGPFWCGFIITASWQTYLNYGDRRLLDRYYPYMQQWLEYVAHYTVDGLLKKWPDTSYRN
WYLGDWATPVGIDQTNPLSVDLVDNCYIAVCYQTMSKIASLLNKADDSRGYKAKYDALTK
RIQETFYDVKENTYASGTQIDLVYPMLAGVTPDNLKETVLKTLYEVTANRFQGHLATGLV
GIPVLTEWAVKNGQAEWMYQMLKKRDYPGYLYMLDNGATTTWEHWNGERSHIHNCYNGIG
AWFYQALAGIMPDESQPGYKRIWIKPQVVNDISWVQASKDTPYGLLKVRWEKKDASFVLD
VQIPVGSSASVSLPFPVENVRVNGQPSESKETLDLESGSYRIECSL

Enzyme Prediction     

No EC number prediction in MGYG000002218_01200.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	349	853	1.1e-132	0.9920634920634921
CBM67	155	320	9.7e-18	0.8806818181818182

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.76e-104	452	787	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	9.71e-40	172	339	4	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam17390	Bac_rhamnosid_C	1.29e-21	789	854	1	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam05592	Bac_rhamnosid	3.70e-18	347	445	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKH96607.1	0.0	13	886	14	882
QGY42782.1	0.0	14	882	13	882
SCM59041.1	0.0	13	886	12	893
QUT97313.1	0.0	1	882	9	889
AST55813.1	0.0	1	882	9	889

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.16e-115	30	854	34	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	9.04e-70	34	886	12	1032	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KNB2	3.39e-111	34	881	42	907	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	4.48e-99	34	883	38	909	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	2.11e-96	38	882	42	947	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	8.16e-69	34	854	12	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KM26	2.16e-10	46	135	490	577	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000001	1.000032	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27