CAZyme Information: MGYG000002215_01045

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia
• CAZyme ID: MGYG000002215_01045
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813	MGYG000002215_29|CGC1	96559.76	5.3783

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002215	3457696	MAG	Spain	Europe

• Gene Location: Start: 1267; End: 3708 Strand: -

Full Sequence      

MKRLELKEGWQMRAVGEENWQEAQVWGSVYTDLLRNGKMEDPYWRDNEDACCALMEKDYE
YRCIFRPESTKEWGDVFLQFEGLDTLAEVFLNGQFLGAACNMHRSWEYQVKELLKEGEEN
VLRVLFHSPLAYIAKAHEKYGTHGNEDTYEGFMHLRKAHYMFGWDWGAHLPDGGIFRPVY
LCYAGQGRILDFHIRQKHRENVCTLEFHADCALEPGGDYELEVRVNQPEGETLGKVVLVQ
GKGELRIENPRLWWVNGLGEQPLYKVTAILYRQGQEEDRWERRIGLRSMRMKREKDKWGE
SFAHEINGQDFFAMGADYIPEEHLLGRRSREKTRRLLEDCKAAHFNVIRVWGGGLYPDDW
FYDICDELGLAVWQDFMFACSVYELTPEFEENIRQELIENVKRIRHHACLALWCGNNEME
MFVDERCWVTKYTEVRDYLFMYERIFPEILREYDPDTFYWPASPSSGGSFDKPNDPDRGD
VHYWQVWHGNRPFSEYRKYFFRYASEFGFQALPQKKTLETVTDRPEDFNLFSYIMEKHQR
NYGANGKIMNYMQQTYRYPGDFDRVIYASQLLQADAIRYGVEHFRRNRGRCMGAVYWQLN
DCWPVISWSSVDYEGRWKALHYYAKRFFAPVMISCQEESWMTQEANMNRQHFTFEKSIHL
NVANETFRDRNIRVRWCLRDAGARILREEEQEIRVPAFTSVWLDKTELPQVNVFEEYVSY
EAWEGENIISQGTVLFSYPKYFRYQNPRLSWEISGSQITVSGEAYAKSVEILNENQDLVL
SDNYFDLNGGSRTVTILRGKPEGIRLRSVWDIR

Enzyme Prediction     

No EC number prediction in MGYG000002215_01045.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	761	3.8e-101	0.7566489361702128

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	7.15e-98	1	807	10	800	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	2.92e-12	188	287	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	5.47e-10	10	418	80	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17753	Ig_mannosidase	2.68e-09	746	811	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10150	PRK10150	1.63e-07	59	315	69	296	beta-D-glucuronidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY97345.1	0.0	1	813	1	811
QMW80334.1	0.0	10	813	34	841
QIB56890.1	0.0	10	813	34	841
ANU78706.2	0.0	10	813	40	849
ASU31771.1	0.0	10	813	40	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	7.94e-148	1	813	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	8.16e-148	1	813	3	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	5.81e-147	1	813	1	846	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	5.97e-147	1	813	3	848	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	2.39e-141	6	797	11	816	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	3.46e-112	6	807	9	837	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
Q4WAH4	9.90e-112	1	638	4	663	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	3.77e-111	1	638	4	663	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1D911	5.48e-110	1	638	4	663	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q5B7W2	7.32e-110	6	645	9	672	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002215_01045.