CAZyme Information: MGYG000002209_01214

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462
• CAZyme ID: MGYG000002209_01214
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
399	MGYG000002209_18|CGC1	46165.7	8.4011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002209	3647221	MAG	Spain	Europe

• Gene Location: Start: 43538; End: 44737 Strand: +

Full Sequence      

MMKNTINRLILCGAVCCSVSLFAQKKVSTELPWSVRMAESEMIRCPEAWQLDFQPKLKWD
YCHGVVLQAFLNLYDAYGDKKYFDYALAYCDTMTYADGSIVTYRPSELSLDRINTGKIYF
RIYEQTKEEKYRRAMENMRAQLVAQPRTKEGGFWHKQVYPHQMWLDGIYMASPFYAEYAF
RNNRPQDYQDVIRQFKVVAKHTYDPKTGLYRHAWDERKAQKWADKQTGQSAHTWGRAMGW
FAMALVDALEFIPKHEAGRDSVMAILDNVAAQIKRWQDKSTGVWYQVIDRSGDEGNYLES
SVSTMFVYTLYKAVRLGFIDASYLDVANKGYDGIMKQFVEVDKDGVVSITKTCAVAGLGG
NPYRSGEYDYYIHEKVRANDPKAVGPFINLCLERERLGK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	52	396	7.8e-119	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.89e-124	33	397	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.70e-106	53	397	28	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT77882.1	9.01e-212	1	399	1	398
QDO69177.1	3.16e-209	1	397	1	396
QUT93209.1	3.00e-207	1	397	1	396
ALJ61262.1	3.00e-207	1	397	1	396
BCA48645.1	5.48e-207	18	399	4	384

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.04e-107	59	397	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	1.41e-85	52	397	32	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	5.86e-85	52	397	22	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	9.27e-20	42	337	48	331	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.92e-18	42	337	49	332	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	7.72e-85	52	397	32	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	5.60e-42	170	388	1	222	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	5.60e-42	170	388	1	222	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	4.00e-18	53	348	23	297	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006332	0.710916	0.281535	0.000574	0.000331	0.000288

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002209_01214.