CAZyme Information: MGYG000002209_00154

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-462
• CAZyme ID: MGYG000002209_00154
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	MGYG000002209_1|CGC3	63038.05	9.5887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002209	3647221	MAG	Spain	Europe

• Gene Location: Start: 188938; End: 190572 Strand: +

Full Sequence      

MRIKHLHLFLLLIICFFTFFVNNKVIYTDIMESRNIVTAREMVYDGHWMVPTMNGELRLE
KPPLPTWIAAGVEMVFPDNMGAQRAMAGLAGTLLVFFFYRLGKRLTQNDTFALASSLVLC
TSYNLILMGRTASWDIYCHAFMLGAIYFLYSGLQEKGRQWKNFLGAGIFLGLSFLGKGPV
SFYALLLPFLVSYALFLRSSLEKKGLPILLMIVICLLISGWWYLFIYFFHSEEARYVLDK
ESTAWIERNVRPWYYYSTFFLETGVWSLMVLTTLLVPYWNKKLRLNREYLFALCWMLFLV
VFLSLLPEKKNRYLLPVLIPAAYTIGFLFTYWTEEIRKNQLDKTGKWLYLINAGLVTLII
FALPIIGYFILYQKGMLSLTSLLLLTILIWGLGAFMVTSITQLKPMRFLSGVVILFIIAE
LFCMPYIGGLVNNPEFKSISGTRQIEALKPLPFYSVAGQELRIELVYEANKKIRPLDVNN
TQEVLEALPCAILTHGRVGEELPSVLWEKVDTVWIDHYDNNRRPKTTKRYSNLFLYNITI
LKKK

Enzyme Prediction     

No EC number prediction in MGYG000002209_00154.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	435	1.6e-70	0.8037037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	9.23e-32	16	372	19	375	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	3.02e-15	61	223	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	3.95e-13	39	296	40	300	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam02366	PMT	5.22e-07	54	233	54	243	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1928	PMT1	2.44e-05	46	174	76	206	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ74247.1	2.46e-20	2	365	7	375
BAI80457.1	5.69e-19	32	368	32	356
AIF51769.1	7.30e-17	10	359	8	356
ACB50888.1	1.19e-16	11	353	32	408
AJQ28749.1	1.36e-16	11	458	20	463

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	2.80e-14	32	355	30	346	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
A0KGY4	9.55e-09	32	362	30	361	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
B2VBI7	5.12e-08	32	326	32	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
A8FRR0	2.69e-07	32	368	34	366	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
A4SQX1	1.08e-06	32	348	30	348	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.964980	0.031942	0.002599	0.000052	0.000044	0.000401

TMHMM  Annotations     

start	end
5	27
81	98
110	132
136	153
165	187
207	229
257	279
289	306
313	332
347	369
376	398
408	430