CAZyme Information: MGYG000002205_00657

Basic Information

• Species: Porphyromonas sp900546675
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Porphyromonadaceae; Porphyromonas; Porphyromonas sp900546675
• CAZyme ID: MGYG000002205_00657
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
282	MGYG000002205_11|CGC1	32998.85	7.5246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002205	2092439	MAG	Spain	Europe

• Gene Location: Start: 40464; End: 41312 Strand: -

Full Sequence      

MLTTGSIVLYKSNAFFVEQIIEDFFRMPSQPQVETDKHLYLIDNSPTDALRFLADLPIGK
GRIYYEHQPSNLGFGKAHNIAIRLAHDQGARYHVIINPDVRFGETVLDTLTSYMEAHEEV
GLVSPFVSYPDGRPQQLCKLLPRPCDVLLRRFSFSQWVRDKINRRYEMHWLDYSEPVEVP
YLSGCFMFTRMAILERVGGFDERFFMYVEDTDLSRRIGQISKTICHPEAKITHVHSRGSY
HDAKLLCHHISSMIKYFNKWGWWCDAERKEVNARYIPKEAKL

Enzyme Prediction     

No EC number prediction in MGYG000002205_00657.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	5.74e-37	6	235	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.19e-35	32	268	28	259	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd02526	GT2_RfbF_like	9.73e-19	7	233	3	203	RfbF is a putative dTDP-rhamnosyl transferase. Shigella flexneri RfbF protein is a putative dTDP-rhamnosyl transferase. dTDP rhamnosyl transferases of Shigella flexneri add rhamnose sugars to N-acetyl-glucosamine in the O-antigen tetrasaccharide repeat. Lipopolysaccharide O antigens are important virulence determinants for many bacteria. The variations of sugar composition, the sequence of the sugars and the linkages in the O antigen provide structural diversity of the O antigen.
cd04185	GT_2_like_b	1.93e-06	38	244	28	183	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02522	GT_2_like_a	4.94e-06	187	232	141	184	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE12519.1	1.12e-206	1	282	1	282
ATS05685.1	1.68e-92	4	272	9	270
ATR93524.1	6.77e-92	4	272	9	270
ATS01209.1	9.60e-92	4	272	9	270
ALJ25660.1	9.60e-92	4	272	9	270

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	1.33e-18	70	263	64	268	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	1.33e-18	70	263	64	268	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002205_00657.