CAZyme Information: MGYG000002203_01568

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000002203_01568
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000002203_16|CGC2	43652.14	5.9593

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002203	2806770	MAG	Spain	Europe

• Gene Location: Start: 69258; End: 70391 Strand: +

Full Sequence      

MKRLITLLMTVALATGCSTSRTTVEPVNPEASPEARQLLEFLYSIRGKYTLAGQHNFISD
PHRYDSVVYSITGKRPVVWGSDFSFNALGDNVADYHHCGPMNLTSPWGECLLNGRSTEEL
RQSLVEEIKQRYAEGRIITLMWHCCFPSECNDCNGASIWTWQNRPSEEVWAELTTDGTPL
NTQWKRQMDTVIPYLKQLRDAGIPILWRPYHEMNGVWFWWCNKPGENGFKKLWIMTYDYF
TRVHKLNNLLWVWNTNAPRDKKGDEAGPYVDYYPGSDYVDVLAADVYHRDYKQSHHDDLQ
ALAGDKLIALGEVGQLPDPTSYHNQPNWSWFMVWGYFINSQKTDSLTSEEAVRNIYNDPR
TLTLDEIELANGRYRLK

Enzyme Prediction     

No EC number prediction in MGYG000002203_01568.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	27	366	1.6e-82	0.9966996699669967

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.93e-44	27	366	1	311	Glycosyl hydrolase family 26.
COG4124	ManB2	2.48e-17	201	287	178	256	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL06294.1	7.01e-267	1	377	1	377
BBL01059.1	5.02e-242	1	377	1	377
ALI98661.1	2.10e-106	26	367	23	328
QEC74531.1	1.35e-102	25	368	23	330
QTE38469.1	5.59e-102	25	368	23	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q75_A	2.52e-98	26	373	23	333	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
3ZM8_A	6.52e-40	28	368	147	448	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
6HPF_A	1.46e-39	26	369	6	312	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3WDQ_A	5.54e-34	26	367	34	352	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
7EET_A	8.10e-28	19	314	6	288	ChainA, Mannanase KMAN [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	1.10e-43	28	368	176	477	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	4.18e-36	16	368	18	351	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	1.39e-33	30	367	150	457	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	3.96e-33	14	365	16	331	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55296	2.10e-31	27	371	158	464	Mannan endo-1,4-beta-mannosidase A OS=Piromyces sp. OX=45796 GN=MANA PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000051	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002203_01568.