CAZyme Information: MGYG000002203_01567

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes
• CAZyme ID: MGYG000002203_01567
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	MGYG000002203_16|CGC2	43206.38	7.8091

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002203	2806770	MAG	Spain	Europe

• Gene Location: Start: 68109; End: 69248 Strand: +

Full Sequence      

MKRTLLLALCLALLPFGWVQGKGKRLKAPEKITLRMVDPDATPETKALYANLWCIGFDGV
LFGHHDYPSYGVGWKGDKDRSDVKDITGSHPAVYSLDMAGINDTKIQHIREAYKRGGVCM
LVWHQSNPLTEGPGKKYPVGTAWDNTKVVDQILQEGSPMNLKYKARLDQVAEAFRKMVDE
KGRPIPVIFRPLHEHTQTWNWWGRSATTDEEFIAFWRFIVSYLRDTKGIHNVIYAISPQM
DAVYKDTEERLLFRWPGDEWVDFLGMDCYHGRNRAAFESNVKAIVGLSAKLGKPVGVTET
GLENNHTSDYWTHDVLPALKGRHCSMVVAWRNESTRHAFGPYPSDASAADFKLFFQDPWT
LLEQDLPDMYTMPRNVTVK

Enzyme Prediction     

No EC number prediction in MGYG000002203_01567.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	37	337	3.5e-59	0.9207920792079208

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.26e-38	37	361	1	307	Glycosyl hydrolase family 26.
COG4124	ManB2	1.34e-11	162	301	159	296	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL06293.1	5.79e-251	1	379	1	379
BBL01058.1	3.43e-231	1	379	1	377
ADF53787.1	8.07e-190	23	378	388	743
AGY53051.1	4.19e-132	61	378	1	323
BBL06287.1	1.23e-120	31	379	75	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VX5_A	4.40e-75	29	370	26	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	4.40e-75	29	370	26	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
4CD4_A	8.33e-75	29	370	49	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	3.46e-74	29	370	26	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]
4ZXO_A	1.07e-70	40	372	7	345	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	3.24e-55	3	373	14	418	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	2.07e-32	14	301	24	318	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	9.87e-20	27	361	22	346	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P49425	5.80e-17	29	301	139	408	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
P55278	4.02e-15	79	305	73	296	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000704	0.995683	0.002979	0.000222	0.000189	0.000184

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002203_01567.