CAZyme Information: MGYG000002195_01767

Basic Information

• Species: Emergencia sp900551775
• Lineage: Bacteria; Firmicutes_A; Clostridia; Peptostreptococcales; Anaerovoracaceae; Emergencia; Emergencia sp900551775
• CAZyme ID: MGYG000002195_01767
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
205		23285.83	5.7727

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002195	4665652	MAG	Spain	Europe

• Gene Location: Start: 1288; End: 1905 Strand: +

Full Sequence      

MRRLLKGVAMTVLITMLIGAVISAPTVYKGYQLYKSAVKETAIAEKVAEIKRSVNYVDLD
DISDYFKEEIIKSEDKRFRFHFGIDPLAIIRAIKNDILAGSFVEGGSTITQQLAKNMYFD
FDKNFERKVAEVFVAFHLEKDYTKDEILEMYLNCIYFGENCYGIKEAANHYYGAVPETIS
KSQADSLVITIKCPNLYNPNELNAA

Enzyme Prediction     

No EC number prediction in MGYG000002195_01767.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	48	201	7.4e-53	0.8700564971751412

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	4.53e-64	56	201	15	160	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	2.93e-56	56	205	4	154	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.02e-56	1	200	20	223	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	5.02e-48	43	199	59	212	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	5.08e-39	6	202	5	199	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SET84136.1	4.95e-76	7	204	9	206
ABX41988.1	9.09e-74	25	200	26	201
BBF43413.1	5.49e-70	1	201	1	201
QQY26839.1	3.34e-55	29	202	26	199
QQV06180.1	3.34e-55	29	202	26	199

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	2.26e-34	56	199	22	165	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	8.98e-34	56	199	22	165	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	2.04e-33	45	203	48	212	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	2.26e-33	45	203	12	176	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	2.32e-33	45	203	13	177	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	1.61e-35	57	199	70	212	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
A5IU40	9.69e-33	45	203	71	235	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain JH9) OX=359786 GN=mgt PE=3 SV=1
A6U2X8	9.69e-33	45	203	71	235	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain JH1) OX=359787 GN=mgt PE=3 SV=1
Q5HEQ0	1.92e-32	45	203	71	235	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=mgt PE=3 SV=1
Q2YU13	1.92e-32	45	203	71	235	Monofunctional glycosyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) OX=273036 GN=mgt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.753223	0.148360	0.047428	0.000987	0.000599	0.049414

TMHMM  Annotations     

start	end
5	27