CAZyme Information: MGYG000002186_00559

Basic Information

• Species: Ruminococcus_A sp000432335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_A; Ruminococcus_A sp000432335
• CAZyme ID: MGYG000002186_00559
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610	MGYG000002186_6|CGC1	70538.38	6.4137

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002186	2911793	MAG	Spain	Europe

• Gene Location: Start: 9768; End: 11600 Strand: -

Full Sequence      

MDSGKWMHYIKKIKPYNIQKGLRYLKHYGPKEFWIRLCERMEPEEIPYGPWFEKHQPDAE
ELERQKKRRFTYSPFISVVVPAYRTPGAFLIQMIESLQNQTYTNWELCIANASPEEKEMG
EILKKYAGEDSRIKVKELQKNLGIAENTNEAFAMAKGEFLGLLDHDDLLAPQALYRMVEM
MNQHLEGKENTLVDVIYSDEDKVTTDLSEHFQPHFKPDFNLDLLRSNNYITHFFVARTAL
VRQTGGFRREYDGAQDYDFIFRCVEQAKMICHIPEILYHWRTHKASTADNPASKMYAFDA
GKRAIEGNLARTGVKGVVSHTKDLGFYQVTYPVQGNPLVSILIPNKDQKEALKKCLDSVF
EKTTYPNYEVIIIENNSQEEETFAYYKELEQRENVKVVTWEAGFNYSAINNFGETYASGE
YLLFLNNDVEVINPRWMEEMLGNCQRREVGITGAKLYYPDGTIQHAGIIIGIGGIAGHAF
LNMPGSRTGYLHKASLQMDLSAVTAACMMMKRSVFKELGGFEEKLAVAFNDVDLCLRTVQ
AGYLVVYDPQVELYHYESKSRGTEDSEEKIRRFQGEIEFMRTRWIKLLKAGDPYYNKNLT
LSKWNYSLRA

Enzyme Prediction     

No EC number prediction in MGYG000002186_00559.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	77	242	8.9e-25	0.9470588235294117
GT2	340	519	2.1e-22	0.9941176470588236

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.43e-89	74	282	1	202	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	4.48e-42	341	557	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	5.60e-28	335	605	1	264	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	7.06e-19	340	515	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam00535	Glycos_transf_2	2.09e-16	77	243	1	161	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM10257.1	0.0	1	610	1	603
QIB58022.1	0.0	1	609	1	605
QMW77454.1	0.0	1	609	1	605
QBE99393.1	0.0	1	609	1	605
QOV20101.1	0.0	1	609	1	604

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Z87_A	3.94e-12	74	315	374	603	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]
2Z86_A	3.95e-12	74	315	375	604	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
5HEA_A	3.67e-07	338	428	6	94	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	1.30e-150	51	608	344	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	1.17e-109	36	609	281	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q58457	6.17e-17	74	281	8	212	Uncharacterized glycosyltransferase MJ1057 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1057 PE=3 SV=2
Q9CMP0	3.68e-14	74	288	433	637	Chondroitin synthase OS=Pasteurella multocida (strain Pm70) OX=272843 GN=fcbD PE=3 SV=1
Q7BLV3	3.69e-14	74	288	440	644	Hyaluronan synthase OS=Pasteurella multocida OX=747 GN=hyaD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002186_00559.