CAZyme Information: MGYG000002186_00431

Basic Information

• Species: Ruminococcus_A sp000432335
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_A; Ruminococcus_A sp000432335
• CAZyme ID: MGYG000002186_00431
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	MGYG000002186_4|CGC2	47460.14	4.312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002186	2911793	MAG	Spain	Europe

• Gene Location: Start: 97989; End: 99251 Strand: +

Full Sequence      

MSPISLKSMQESQPDKGKLQIQVKTKIQSRPIVGAKISISYKGAPDSTLEEVETDRNGQT
EVLELPTPPVEYSLTPSEQQPYSEYNLRVQAPGYEPVEVSGAELLSGETSIQQVAMEPSE
QGPFQDIVIPDHTLYGNYPEKIPEAEIKPMNETGEIVLSRVVVPEYVVVHDGAPSDSTAQ
NYFVRYKDYIKNVASSEIYATWPLETIRANVLAIMSFTMNRVYTEWYRNKGYSFTITSST
AFDHKWIFGRNIFESISQVVDELFENYLSRPNVRQPILTQYCDGQRVRCDGWMSQWGSKY
LGDQNYSAIEILRNYYGDNMYINSAEEISGIPISWPGYDLDIGSSGIKVRQIQEQLNGIS
EAYPAIPSVNPDGIYGEETKEAVREFQSVFGLPETGVVDYPTWYKIQEIYVGVSRIAELN

Enzyme Prediction     

No EC number prediction in MGYG000002186_00431.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01471	PG_binding_1	7.08e-14	345	406	1	57	Putative peptidoglycan binding domain. This domain is composed of three alpha helices. This domain is found at the N or C-terminus of a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. This family is found N-terminal to the catalytic domain of matrixins. The domain is found to bind peptidoglycan experimentally.
COG3409	PGRP	5.13e-09	342	408	41	104	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
COG3409	PGRP	1.48e-07	336	406	117	183	Peptidoglycan-binding (PGRP) domain of peptidoglycan hydrolases [Cell wall/membrane/envelope biogenesis].
pfam13620	CarboxypepD_reg	1.40e-06	30	116	12	81	Carboxypeptidase regulatory-like domain.
cd01450	vWFA_subfamily_ECM	0.009	175	275	10	105	Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF). Typically, the vWA domain is made up of approximately 200 amino acid residues folded into a classic a/b para-rossmann type of fold. The vWA domain, since its discovery, has drawn great interest because of its widespread occurrence and its involvement in a wide variety of important cellular functions. These include basal membrane formation, cell migration, cell differentiation, adhesion, haemostasis, signaling, chromosomal stability, malignant transformation and in immune defenses In integrins these domains form heterodimers while in vWF it forms multimers. There are different interaction surfaces of this domain as seen by the various molecules it complexes with. Ligand binding in most cases is mediated by the presence of a metal ion dependent adhesion site termed as the MIDAS motif that is a characteristic feature of most, if not all A domains

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY98201.1	2.63e-224	6	419	6	420
QJU14725.1	6.16e-223	6	419	6	420
QQQ92685.1	6.16e-223	6	419	6	420
ASU27931.1	6.16e-223	6	419	6	420
ASM69598.1	6.16e-223	1	419	1	420

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002186_00431.