CAZyme Information: MGYG000002178_01090

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; CAG-617
• CAZyme ID: MGYG000002178_01090
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
970	MGYG000002178_80|CGC1	107655.6	4.4343

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002178	2197502	MAG	Spain	Europe

• Gene Location: Start: 243; End: 3155 Strand: +

Full Sequence      

MKHFLLLGAALAFGLTTLPAAAQQVTVSPLPQNITWGEGKAFDNTTTFTLVGADEADADA
VTLLKESLTTGEGGVELVIGERGDEAVAEYEANIPEHEQGYYLSVGADRVVIAGNDVTGT
YYGVQTFLQVASQPEVQSVTVTDYPLVLERGVIEGFYGNPWSETDRIRQFEFYGQNKMNI
YIYGPKDDPYHRNQWRTPYPDAEAAELQRLIEAAHKNKVQFVWALHPGLDIQWNDTDRQN
VIDKLESVYELGCRRFALFFDDISGNGGNPAEQAKLLNYVTENFIHKHGLEPLIMCPTEY
NRGWVTGSGEYLTTLGSNTDPEVLIMWTGNSVVDMIQKADLDYINPRLERNAFIWLNYPV
SDYCTEHLLMGKTYGNDLNIAGQLGGFASNPMEYAEASKVSLYSIADYTWNMTQYDAEAS
WERAIKALWPGHAEAFKTFCESNVDLGTTTHGLRREGETPDFVEPANAFEESIDKGYDAG
KAAAVKAVFTKMVAAADELLASDDQPEMLNEIKPWLQVMKLQAQRGEKLIDLFARIDAKD
PDGFVTLYKEMQELETKQKSIRSRDFEGSIKNPNPTVASNYVEPFLASVTGRAIAEYKAH
FDEHWDVFPAVVLEDGSYYIMNADRYLTNNNPGQLGGYPTFTATADNINPQKQEWNISMD
YTTNRYKVTNAQDNRYLNENGAFAASNEINPYEAVWHTYVVYRLNGKYAIQNAGNSGKKF
WTVNGNRIQQGSNNEWSTSSLVFDIVPMSGEVKHPMFEDGKEVYITYNGKYLTNNNVGGS
GQTPTFKGRLANDTRKTQQWKLTVDSETGRYKLVSAADNRYVNELGAFGTNAYDATWNTY
VISEVGGLYSIQNAGESGTEYWTVEDDRITDAGSNRDESFIFGIEPVNPSTSGIDGVTAD
KGVLKYQIGEETITVSGRNGIREVQLVSANGLTVASSRGAATISTTGLPTGAYVLVVKGN
GWEETAKVAL

Enzyme Prediction     

No EC number prediction in MGYG000002178_01090.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	150	440	4.9e-108	0.9932203389830508

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	7.04e-154	150	439	1	293	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.
pfam02838	Glyco_hydro_20b	1.08e-14	29	143	6	123	Glycosyl hydrolase family 20, domain 2. This domain has a zincin-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ13183.1	3.82e-264	13	750	13	737
QUB43766.1	2.81e-179	77	677	71	669
QUT42280.1	6.28e-167	6	606	8	606
QMW86728.1	8.85e-167	6	609	8	613
AAO79500.1	8.85e-167	6	609	8	613

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VVN_A	3.23e-168	6	609	8	613	BtGH84in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVN_B BtGH84 in complex with NH-Butylthiazoline [Bacteroides thetaiotaomicron VPI-5482],2VVS_A BtGH84 structure in complex with PUGNAc [Bacteroides thetaiotaomicron VPI-5482],2X0H_A BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],2X0H_B BtGH84 Michaelis complex [Bacteroides thetaiotaomicron VPI-5482],4AIS_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],4AIS_B A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482],7OU8_AAA Chain AAA, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482],7OU8_BBB Chain BBB, O-GlcNAcase BT_4395 [Bacteroides thetaiotaomicron VPI-5482]
2WZI_A	1.79e-167	6	609	8	613	BtGH84D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482],2WZI_B BtGH84 D243N in complex with 5F-oxazoline [Bacteroides thetaiotaomicron VPI-5482]
2WZH_A	1.79e-167	6	609	8	613	BtGH84D242N in complex with MeUMB-derived oxazoline [Bacteroides thetaiotaomicron VPI-5482],4AIU_A A complex structure of BtGH84 [Bacteroides thetaiotaomicron VPI-5482]
7K41_A	1.59e-166	22	609	3	595	ChainA, O-GlcNAcase BT_4395 [Escherichia coli K-12]
2CHO_A	2.05e-166	23	609	1	592	Bacteroidesthetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482],2CHO_B Bacteroides thetaiotaomicron hexosaminidase with O-GlcNAcase activity [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q89ZI2	1.77e-167	6	609	8	613	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1
Q0TR53	5.43e-97	27	532	46	571	O-GlcNAcase NagJ OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) OX=195103 GN=nagJ PE=1 SV=1
Q8XL08	1.04e-96	27	532	46	571	O-GlcNAcase NagJ OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagJ PE=1 SV=1
P26831	2.79e-49	27	589	41	647	Hyaluronoglucosaminidase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=nagH PE=1 SV=2
O60502	2.43e-35	151	410	63	331	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000217	0.999150	0.000158	0.000169	0.000154	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002178_01090.