CAZyme Information: MGYG000002176_00493

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; SFTJ01
• CAZyme ID: MGYG000002176_00493
• CAZy Family: GH16
• CAZyme Description: Keratan-sulfate endo-1,4-beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
266	MGYG000002176_10|CGC1	30159.23	6.1545

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002176	2675847	MAG	Denmark	Europe

• Gene Location: Start: 35225; End: 36025 Strand: +

Full Sequence      

MRFITTLTALIVCALAFATSPHKYRLVWQDDFNGSSFDACSWTKIKRSASDWDRHMSPAD
SLYAVRDGKLILRGAVNTNLEADTARYVTGGLYTRHKRTIKYGKVEVRARLGCAQGAWPA
IWMLPDGDVKWPDGGEFDIMEHLNHDTIAYQTVHSYYTFVLKKDNEPPHGSVLPIDREGY
NTYAVEILPDSLVFSINGKTSFSYPRIATTEKGPYPFGTPYYLLVDMQIEGAWVGKADPK
QLPVEMEIDWVRFYDLEGVEPSTEVK

Enzyme Prediction     

No EC number prediction in MGYG000002176_00493.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	28	254	9.9e-51	0.9956521739130435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd08023	GH16_laminarinase_like	2.19e-67	28	254	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
cd00413	Glyco_hydrolase_16	4.59e-27	30	254	1	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
COG2273	BglS	2.17e-22	1	255	15	264	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
cd02182	GH16_Strep_laminarinase_like	3.20e-16	24	254	2	258	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
pfam00722	Glyco_hydro_16	4.72e-16	84	252	16	168	Glycosyl hydrolases family 16.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO25177.1	1.69e-118	11	256	9	258
QHQ88360.1	6.82e-100	22	257	34	270
ATL42290.1	4.05e-99	22	257	33	269
QQN58834.1	3.29e-98	22	257	33	269
QDZ62311.1	3.29e-98	22	257	33	269

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2R_AAA	6.15e-97	18	254	23	261	ChainAAA, Beta-glycosidase [Bacteroides caccae]
3ILN_A	2.15e-30	21	254	3	247	ChainA, Laminarinase [Rhodothermus marinus],3ILN_B Chain B, Laminarinase [Rhodothermus marinus]
6XOF_A	1.72e-29	21	254	21	266	ChainA, GH16 family protein [uncultured bacterium]
6XQF_A	9.22e-29	21	254	21	266	ChainA, GH16 family protein [uncultured bacterium],6XQG_A Chain A, GH16 family protein [uncultured bacterium],6XQH_A Chain A, GH16 family protein [uncultured bacterium],6XQL_A Chain A, GH16 family protein [uncultured bacterium],6XQM_A Chain A, GH16 family protein [uncultured bacterium]
6T2N_AAA	7.24e-27	19	254	47	302	ChainAAA, Glycoside hydrolase family 16 protein [Akkermansia muciniphila],6T2N_BBB Chain BBB, Glycoside hydrolase family 16 protein [Akkermansia muciniphila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZG90	2.78e-41	24	256	56	289	Keratan-sulfate endo-1,4-beta-galactosidase OS=Sphingobacterium multivorum OX=28454 PE=1 SV=1
P45798	6.27e-31	20	254	37	282	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1
P23903	1.47e-24	25	254	424	679	Glucan endo-1,3-beta-glucosidase A1 OS=Niallia circulans OX=1397 GN=glcA PE=1 SV=1
Q27082	5.21e-16	23	254	24	252	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
Q9Z3Q2	8.45e-12	63	258	276	461	Endo-1,3-1,4-beta-glycanase EglC OS=Rhizobium meliloti (strain 1021) OX=266834 GN=eglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000237	0.999125	0.000160	0.000157	0.000141	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002176_00493.