CAZyme Information: MGYG000002171_01333

Basic Information

• Species: Phocaeicola sp002493165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002493165
• CAZyme ID: MGYG000002171_01333
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232	MGYG000002171_27|CGC1	27105.61	8.906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002171	3793747	MAG	Denmark	Europe

• Gene Location: Start: 8999; End: 9697 Strand: +

Full Sequence      

MIPKIIHYCWLSNNPIPSKLQEYMESWKKQLPDYEFILWNFERFDINSSIWVKQAFEAKK
YAFAADYIRLFAVYHYGGIYMDMDVEVVKSFNSLLNNSCILGKEGSNAIEAGVFGAEKNA
VWIKECLGYYEDRCFMRPDGSFDIKPLPLIMYDILYDRYIKNGTLSIFEPVFLTAKSSAT
GKIYATRDTYTIHHFAGSWVPKSRKIALILKPIIGEKIIDWIIKQRKSLKWL

Enzyme Prediction     

No EC number prediction in MGYG000002171_01333.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	97	9.4e-23	0.9555555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	1.20e-23	1	97	81	180	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	1.06e-18	17	99	1	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	1.71e-04	1	98	45	148	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.002	4	111	1	110	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT44427.1	5.73e-90	1	218	1	229
AEF84277.1	4.05e-81	1	205	1	206
QRO25778.1	4.59e-80	1	232	1	235
ALJ04028.1	7.95e-78	1	224	1	244
AXV49987.1	8.43e-78	1	201	1	214

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33300	4.51e-11	1	172	54	234	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
Q10323	6.42e-10	2	118	57	176	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
O14084	3.49e-09	2	101	64	169	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
P38287	1.83e-08	1	170	61	240	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
Q9UT67	1.03e-07	1	95	81	178	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002171_01333.