CAZyme Information: MGYG000002171_01173

Basic Information

• Species: Phocaeicola sp002493165
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp002493165
• CAZyme ID: MGYG000002171_01173
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MGYG000002171_22|CGC1	47212.75	6.8509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002171	3793747	MAG	Denmark	Europe

• Gene Location: Start: 32884; End: 34116 Strand: +

Full Sequence      

MESKSICKFIVSGLLMIAPLLCGAQKVCDKQPWSVRMATSEMMRCPESWQLDFQTRLKWD
YCHGLELQSMLDVYDAYGDKKFFDYAVAYADTMIHADGSIETYKLHEYNIDRLNSGKMLF
RIYEQTKDEKYRKALDLLRSQLDTHPRNADGGFWHKKIYEHQMWLDGLYMGQPFYAEYAY
RNNRVNDYADIINQFVTVARHTYDAENDLYRHACDVSKRERWADKVTGQSQHCWGRAMGW
YAMACVDVLDFIPQHEVGRDSVIAILNKLAAQIKRTQDTRTGVWYQVIDRSGDKGNYLES
SCSTMFVYALLKAVRKGYICSSYMEVAQKGYEGILKQFIEVDDKGLVSITSACAVAGLGG
KNYRMGDYDYYINEQIRVNDAKAVGPFIMASLEWERLHANGGSGCKTPLE

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	51	396	4.3e-120	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.69e-126	33	397	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	6.31e-104	53	397	28	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR39473.1	1.77e-265	1	404	1	405
QQY38334.1	1.77e-265	1	404	1	405
QUT59627.1	1.77e-265	1	404	1	405
QQY41712.1	1.77e-265	1	404	1	405
ALK82868.1	1.77e-265	1	404	1	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	1.09e-112	59	397	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.89e-79	58	402	38	372	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.62e-78	58	402	28	362	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	1.13e-20	147	397	183	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	2.31e-17	42	336	48	330	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	2.13e-78	58	402	38	372	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	5.08e-42	170	393	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	5.08e-42	170	393	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000254	0.999167	0.000162	0.000143	0.000134	0.000121

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002171_01173.