CAZyme Information: MGYG000002164_00204

Basic Information

• Species: Methanosphaera stadtmanae
• Lineage: Archaea; Methanobacteriota; Methanobacteria; Methanobacteriales; Methanobacteriaceae; Methanosphaera; Methanosphaera stadtmanae
• CAZyme ID: MGYG000002164_00204
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	MGYG000002164_1|CGC1	76594.59	7.5691

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002164	1767403	Isolate	not provided	not provided

• Gene Location: Start: 249489; End: 251447 Strand: +

Full Sequence      

MKIPHIFDEDIERIRELRNEVSDSKNIFKDKVSSVLKSSIKNKKVLSKQERKEVSLKILN
DNKSHEIPLNKKLPLVSIIIKATHKNYLLNLLNTFSTLDTYYSNYELIIIHNMKDDLLKY
IDNKKDVILVSCEDKSLTQAENEASHKSKGEYLLFIDDDTIPFDGFLNHMVNTMLTKENV
GVVGSRLIYPELKLNRTKSYKVAHEGIYFREKNNLIETYNKNDGRRYYTADEEECEVIAT
SSVAFLVKKSVLMGVGGFNENYVEFYEVIDLCLRLHKKDYKNYYNPKVMLYHFCLENHDV
DVFERDKKIFINTWNKYILHNLLKDKLYANYLFSDKALTVALVVTQSVCETTAGDFFTAI
TLAHNLKDFGWNIKFLSQHPSKYERNWYHLDDDIDVVISLLDRYNLRKIESNRKSLIKVA
WIRNWFERWMKLSYLDDYNIILSSSKKACGVIGEKIDRKVYFYPLATDSTIFNEKLQPNN
EYICDYCFTGSYWKSDREIISALCPDNIDYTFNLYGANWDKIPSLKKYHKGFIKYDDIPQ
VYASTKIVLDDANHVTRGWGSVNSRVFDAFASGCLVLTNGTMGNTDLFNGMIPEYHSKEE
LQDKLNYYMEHTHEKEKIVQEIQEIILEKHTYKHRATKLKSLLNFYIHKYTD

Enzyme Prediction     

No EC number prediction in MGYG000002164_00204.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13524	Glyco_trans_1_2	1.02e-19	547	639	1	91	Glycosyl transferases group 1.
cd04186	GT_2_like_c	1.86e-17	77	293	1	165	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd02525	Succinoglycan_BP_ExoA	4.32e-14	75	293	1	208	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
COG1216	GT2	3.47e-13	74	321	3	248	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
COG1215	BcsA	5.93e-11	63	289	43	261	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABC56620.1	0.0	1	652	1	652
ABC56900.1	3.59e-207	46	646	126	734
AWX32696.1	7.17e-184	1	650	1	664
AWX32698.1	1.18e-164	43	649	438	1057
AWX32971.1	2.67e-163	74	647	423	1011

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000071	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002164_00204.