CAZyme Information: MGYG000002163_00467

Basic Information

• Species: Methanobrevibacter_A smithii
• Lineage: Archaea; Methanobacteriota; Methanobacteria; Methanobacteriales; Methanobacteriaceae; Methanobrevibacter_A; Methanobrevibacter_A smithii
• CAZyme ID: MGYG000002163_00467
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
512	MGYG000002163_10|CGC3	59706.47	5.0671

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002163	1727775	Isolate	not provided	North America

• Gene Location: Start: 451051; End: 452589 Strand: -

Full Sequence      

MSDISYSKFLIKSKFNPKKAKKYMESYDKIMESGLFDKNYYLKAYPHIAKSGMDPLVHYL
FYGYKEDKNPSAQFNLKRYLEEYPEIKRKGLNPLVHYIDNDHEGFTLEENPFIARRKKIL
DTNSLFLANYSFDSEPLVSIIILNRNGLGHLQRLFADFDKKTNYSNYEIIVVDNASCDES
VEYLHSLDLPVTVIENSENVSFSKGNNDAAKIANGEYLLLLNNDIEPTYGWLNEMVGTAL
NNENVGSIGAKLVFPYYEDMESQGKSFSIQHAGVKFREERTPYIYGPYHEHMYSTMLFSD
ELNHQKEVISNTAACLLVPKDVYFELDGLDEQYIYGYEDIDFAFKLYKAGYKTIYNPAVL
LFHHESATRHEDDDRKNQLNYHNIMHFADKWGNFIFKEILKDKIEANKFFTNKKLDFSII
SKNNDLIKKVVSKLNNECYNVKLIPNIDDLDIGQDCDILISTEKEYDIKNVSSRLNLIKI
LISDENNNDYDMVLSENDFEFNLLDKIKEKYL

Enzyme Prediction     

No EC number prediction in MGYG000002163_00467.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	139	267	3.1e-21	0.7705882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	3.52e-41	140	365	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	1.34e-27	134	429	1	283	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	6.55e-17	139	302	1	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	2.02e-14	140	254	1	117	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd02522	GT_2_like_a	5.24e-10	138	350	1	173	GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function. Glycosyltransferase family 2 (GT-2) subfamily of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ87517.1	0.0	1	512	1	512
ATZ60506.1	0.0	1	512	1	512
ALT70026.1	1.28e-256	4	512	2	511
ABQ87526.1	2.86e-144	9	501	8	502
ATZ60513.1	4.05e-144	9	501	8	502

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MLZ_A	5.08e-06	138	282	25	177	Dolichylphosphate mannose synthase in complex with GDP and Mg2+ [Pyrococcus furiosus DSM 3638],5MM0_A Dolichyl phosphate mannose synthase in complex with GDP-mannose and Mn2+ (donor complex) [Pyrococcus furiosus DSM 3638],5MM1_A Dolichyl phosphate mannose synthase in complex with GDP and dolichyl phosphate mannose [Pyrococcus furiosus DSM 3638]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	4.29e-24	126	391	615	874	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.99e-16	126	372	564	801	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002163_00467.