CAZyme Information: MGYG000002158_01815

Basic Information

• Species: Desulfovibrio desulfuricans_A
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio desulfuricans_A
• CAZyme ID: MGYG000002158_01815
• CAZy Family: GH108
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
227		25576.83	7.1469

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002158	2806718	MAG	Germany	Europe

• Gene Location: Start: 15512; End: 16195 Strand: +

Full Sequence      

MSNFFQKAHEFTARWEGGLTDYPSDPGGLTNHGVSLRWVQDLARQAREDCQRQARSCDGC
NAMRTSKCGYYSLDMDMDGDVDADDIRACTKAQAAALFKKHFWNKLACNGLPLPLAVTLY
DGAVNMGPARAVRQMQRAMNTVGESELDRYAPIAEDGIMGPRTAQLAEALEQSGQQWYAA
RQILRLRDAFYRDLAARRPSMQVFLNGWRNRVKALGQYLGELEREEN

Enzyme Prediction     

No EC number prediction in MGYG000002158_01815.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH108	10	127	5.4e-33	0.9651162790697675

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3926	ZliS	1.23e-24	1	212	1	161	Lysozyme family protein [General function prediction only].
pfam05838	Glyco_hydro_108	1.57e-23	10	127	2	86	Glycosyl hydrolase 108. This family acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a C-terminal pfam09374 domain.
cd13926	N-acetylmuramidase_GH108	2.63e-17	5	127	3	91	N-acetylmuramidase domain of the glycosyl hydrolase 108 family. This domain acts as a lysozyme (N-acetylmuramidase), EC:3.2.1.17. It contains a conserved EGGY motif near the N-terminus, the glutamic acid within this motif is essential for catalytic activity. In bacteria, it may activate the secretion of large proteins via the breaking and rearrangement of the peptidoglycan layer during secretion. It is frequently found at the N-terminus of proteins containing a peptidoglycan binding domain.
pfam09374	PG_binding_3	2.52e-08	130	211	1	74	Predicted Peptidoglycan domain. This family contains a potential peptidoglycan binding domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VZH34560.1	2.84e-143	1	226	1	226
QCC85041.1	8.49e-129	1	227	1	227
AMD89012.1	1.34e-125	1	224	1	224
SFV73167.1	9.17e-110	1	225	1	225
SPD36756.1	1.06e-35	1	219	1	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DNP_A	3.63e-13	5	212	6	159	ChainA, Secretion activator protein, hypothetical [Brucella abortus bv. 1 str. 9-941]
2IS5_A	1.72e-09	16	173	17	124	Crystalstructure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_B Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_C Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B],2IS5_D Crystal structure of 3 residues truncated version of protein NMB1012 from Neisseria meningitides [Neisseria meningitidis serogroup B]
2IKB_A	1.75e-09	16	173	16	123	CrystalStructure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_B Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_C Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58],2IKB_D Crystal Structure of a Protein of Unknown Function NMB1012 from Neisseria meningitidis [Neisseria meningitidis MC58]
6V3Z_A	4.86e-06	16	208	33	192	ChainA, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis],6V3Z_B Chain B, Sen1395 [Salmonella enterica subsp. enterica serovar Enteritidis]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002158_01815.