CAZyme Information: MGYG000002157_01201

Basic Information

• Species: Amulumruptor sp001689515
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; Amulumruptor; Amulumruptor sp001689515
• CAZyme ID: MGYG000002157_01201
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423	MGYG000002157_19|CGC1	47134.54	5.562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002157	2499032	MAG	Germany	Europe

• Gene Location: Start: 4968; End: 6239 Strand: -

Full Sequence      

MDTRHLLDIAAMPCHDGIVELQLRPGHLSWLPLGRERIASVLNDTGAMMAYADGVGEPHI
DLQLGAIRDDFDFGPVVLIRHDIFCRCVKSLDTDLRGAAFYALRLMIQRLGKIVHIPEAL
YTFDASASSTGQFDYVDPRNAAIQAEMEQVATAHLSAIGALISQPQVSQVNIDEGFFPVE
VSVVIPVRNRVSTIRDAVLSALSQSLDCTMNVLVVDNHSSDGTSQVLAELAASHPRLKVI
VPECDHLGIGGCWNRAIDDAACGRFAVQLDSDDIYSGADTLQRIVDTFRRERCAMVVGAY
RLTDFDLNTIPPGLIDHKEWTDFNGRNNLLRVNGMGAPRAFLTRIARELHFPNVSYGEDY
AMALRISRSYHIGRIYDELYLCRRWQGNSDAQLDRATLNRYNSYKDFLRTAELEARILIN
SQS

Enzyme Prediction     

No EC number prediction in MGYG000002157_01201.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	182	321	1.8e-20	0.7941176470588235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	9.93e-18	182	314	1	129	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	7.65e-16	183	326	1	146	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	5.46e-15	180	420	4	233	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd02525	Succinoglycan_BP_ExoA	3.21e-14	181	302	2	120	ExoA is involved in the biosynthesis of succinoglycan. Succinoglycan Biosynthesis Protein ExoA catalyzes the formation of a beta-1,3 linkage of the second sugar (glucose) of the succinoglycan with the galactose on the lipid carrie. Succinoglycan is an acidic exopolysaccharide that is important for invasion of the nodules. Succinoglycan is a high-molecular-weight polymer composed of repeating octasaccharide units. These units are synthesized on membrane-bound isoprenoid lipid carriers, beginning with galactose followed by seven glucose molecules, and modified by the addition of acetate, succinate, and pyruvate. ExoA is a membrane protein with a transmembrance domain at c-terminus.
cd04179	DPM_DPG-synthase_like	7.57e-13	183	298	1	114	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD34713.1	2.03e-149	27	420	34	432
QCD38257.1	3.28e-147	3	423	7	444
QQR07999.1	1.75e-143	4	420	15	438
ANU64635.1	1.75e-143	4	420	15	438
ASB37260.1	1.75e-143	4	420	15	438

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002157_01201.