CAZyme Information: MGYG000002149_02514

Basic Information

• Species: Blautia sp003287895
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Blautia; Blautia sp003287895
• CAZyme ID: MGYG000002149_02514
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
752	MGYG000002149_55|CGC1	84520.23	4.7242

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002149	2886615	MAG	United States	North America

• Gene Location: Start: 337; End: 2595 Strand: +

Full Sequence      

MTTMKKQKASKKIRYYENENGPKIGVVYQQVICEEGLYFRDINGDGKLNTYKDWRKSPKE
RAKALAAELSVEEKIGQLFLSSWKMGIEQEDKGFVDETGLLDEKPVEKGSSIFAVNSTVG
TTETIKDWKVRHFILRGNPKPEELADWINEMNSVAEESEYFLPVLVISNSRNENGEVVFG
MNDASGVFAAWPGTLGIAAAVKGAGTGLIDDFASCIRREWDAVGMKKGYMYMADCMTDPR
WQRTYGTFGEDSQLISDILERLIPGVQGSEEGVTRDGVAMTVKHFPGGSARENGFDPHYK
QGQWNVYQTENSLETYHLPPFKTAVKKHTSSIMPYYAKPAKEKSREQYDLQGRPIEWKPV
GFAFNDFFINKMLREQMGFEGYINSDSGIMQMMAWGVEELEICERAALAINAGVDIISGS
YDLEDAKEAYRRWKEGYYTKQGHEVPKGYTAEQLTLSEEALTRAVERTLTEKFALGLFEN
PYRNPQEAAEIVKNPKDWENAQKVHRQSVVLLKNDGTLPLTFDKISDKKVYARCYHKIEE
NAEKATAELKKQLQKEPLLTLTENPEEADVAILFVSPSSGEYFNATPGYLELDICDGKEV
CDVDEEGRPAKTTHLETTLLKVKELAEIAEAVHANHGKVVTNINFTLAWQVGNAEPYADA
LLAGFDTYPGAVLDVIFGRFSPVGKMPITLPKDDSVLAVNADGVCISPNDVPGYDKDQYM
PEEMKDENGKAYAYRDTAGNYYELNFGLHYEQ

Enzyme Prediction     

No EC number prediction in MGYG000002149_02514.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	156	417	1.5e-46	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.21e-43	69	538	1	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	3.30e-22	70	470	1	315	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	3.50e-21	232	520	158	407	beta-glucosidase BglX.
PLN03080	PLN03080	1.72e-13	238	526	163	421	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.64e-07	509	695	1	194	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY99446.1	0.0	4	752	1	749
QIX92882.1	0.0	8	748	3	744
ASN94235.1	0.0	8	748	3	744
QRP41088.1	0.0	8	748	3	744
QJU21464.1	0.0	8	748	3	744

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M6G_A	1.72e-23	176	700	129	597	Crystalstructure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
5XXL_A	8.83e-18	177	516	86	378	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.51e-17	177	516	86	378	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	1.44e-16	234	520	183	429	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5Z9S_A	2.52e-16	188	525	101	402	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8NGU6	3.78e-63	45	701	36	600	Probable beta-glucosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglC PE=3 SV=1
Q2UFP8	8.89e-60	51	701	46	604	Probable beta-glucosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglC PE=3 SV=2
Q46684	2.05e-58	31	573	38	527	Periplasmic beta-glucosidase/beta-xylosidase OS=Dickeya chrysanthemi OX=556 GN=bgxA PE=3 SV=1
Q5BCC6	9.45e-57	48	702	35	596	Beta-glucosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglC PE=1 SV=1
T2KMH9	2.76e-24	51	692	29	601	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002149_02514.