CAZyme Information: MGYG000002148_02435

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000002148_02435
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688	MGYG000002148_22|CGC1	76739.31	5.14

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002148	4597814	MAG	United States	North America

• Gene Location: Start: 24388; End: 26454 Strand: +

Full Sequence      

MKCTKKYRLSYSKKAEEIVAGLTLQEKISLMGGNNGQMESPADAKLDHYNYMPFPAGGIE
RLHIPPVLFCDGPRGVVCGTGKTTCFPVSMLRGATFDTELEEKIGHAVGKETKASKGNLF
AGVCINLPYHPGWGRSQETYGEDSFHISEMGSAMVRGIQEENVIACLKHFAFNSMEISRF
KVNISCDVRTEREVYLKHFEKCIKAGAGAVMSSYNKYHNVYCGHNDYLLNQVLKKEWDFD
GFVMSDFNWGVRDTIEAANGGQTMEMCETKYFGRRLEEAVKSGQVSEACIDDAALRIVRT
LLAFTQADEKEYKEELLGCREHIDLALQAAREGITLLCNDKNVLPFCEEKIKRIAVIGRL
ADTEVTGDHGSSRVFPPYVISPLSGIRKRLKDDNIKIIYEDGTDIEKAMKAASTSDAVVF
VVGYDYFDEGEYVLKDETNTAGGGYGGDRTESLGLHEEDVELLRRVGPCNENSVAVLIGG
NAILIERFKEYVSAVIMAFYPGMEGGTALAEILFGDVNPSGKLPFVLPKKECDLPDICWD
TEEQYYDYFHGYAKLDKEGIEPAVPFGFGLSYTKFEVKNAGFIVADGYIKASCEIENVGE
RKGAEVLQFYVGFPRSKVKRPVKTLCGFKRVELSPGEYRAVEISCPVRELDWYNPETRKW
ETERNVYTGYIGTSSALRDLLKGEFTLG

Enzyme Prediction     

No EC number prediction in MGYG000002148_02435.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	58	248	9.7e-57	0.875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.32e-78	81	687	115	764	beta-glucosidase BglX.
PLN03080	PLN03080	5.23e-60	9	659	47	757	Probable beta-xylosidase; Provisional
COG1472	BglX	2.23e-59	61	362	57	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.11e-55	334	572	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	8.21e-36	61	299	63	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QES74816.1	0.0	1	687	1	689
AVK47794.1	0.0	1	687	1	689
ALB45051.1	0.0	1	687	1	689
QUN34009.1	0.0	1	687	1	689
AIU02384.1	0.0	1	687	1	689

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.63e-105	16	684	6	664	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	4.27e-92	14	688	3	714	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	6.18e-91	14	688	3	714	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	3.77e-76	9	676	48	818	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
5WAB_A	7.05e-76	19	675	9	652	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	1.99e-104	16	684	6	664	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
A7LXS8	2.13e-91	54	676	68	735	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q0CEF3	5.45e-84	14	687	31	736	Probable beta-glucosidase L OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=bglL PE=3 SV=1
P27034	2.63e-80	16	675	3	799	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
T2KMH0	1.19e-79	13	687	35	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.995410	0.004413	0.000115	0.000018	0.000011	0.000042

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002148_02435.