CAZyme Information: MGYG000002148_00526

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella
• CAZyme ID: MGYG000002148_00526
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
704	MGYG000002148_2|CGC2	80835.11	5.9809

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002148	4597814	MAG	United States	North America

• Gene Location: Start: 37747; End: 39861 Strand: +

Full Sequence      

MKKLEIEEIGLYLCFSLESGQEARLLKVCSKKPEEGWEEKCVEEASRIVEIRVSGGKCKA
FRGAKNFYDHPQTVLRYVRHRLTENESGRQLVISQEGDGLVVHTCYQFYRGLPVFSCESE
VINRSPDEIWLEGVTSFCYGNLDYFRKGDTNPAEELELWYAHNTWSAECRWKRQTLQECG
VIPYGNLCYDRFCISNAGGFSSGEFLPEGAAYNRRTGESIFWQIEHNGSWSWEIGCSVPE
YGLSFLEKEYLQPVYLLLSGPETEKAHWYKKLKSRESFRTVPAAVSVSRGKPEEGISWMT
QYRRRKKRIKKLPVIFNDYMNCLMGNSTTASLLPYIRKAGEAGCEIFVVDCGWYDSRDWQ
FTLGTFEECRQRYPAGLTEVMDCIRAAGMEPGLWLELESFGTDNPAAGELPKDWLFCRNG
KPVMDSGRYQLDFRNADVRENASSIVKRVIEKYGLKYIKMDYNMCCGWGTDFHSDSLGDG
LLEHNRAYLDWLEKEREKYPGILWENCASGGLRMDYALLSQMDIQSVSDQEDYRIMAFIA
SNCAAALLPEQAGIWCYPRKEGDCRETVMNLVSGMLFRIHLGGHLAKLDGDRFLLVKEGI
ACHKRIRQEIPESLPYWPLGMHVFDSPWLCWGLHGPKADYIAVCRRMAEEEVLSFPVKRT
PVSVRILYAVSGETEIVSSDPQNRRIQVRLEYRNSACLIEVKDS

Enzyme Prediction     

No EC number prediction in MGYG000002148_00526.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	69	636	1e-69	0.7718023255813954

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	5.85e-71	312	605	2	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.32e-24	330	532	58	263	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	1.13e-18	328	532	307	508	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASS97000.1	1.82e-189	4	701	12	703
QKE72774.1	6.75e-185	2	701	10	703
BBS49382.1	3.31e-184	4	699	4	681
QYD22195.1	3.31e-184	4	699	4	681
QTH40264.1	3.03e-183	4	701	7	696

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	1.23e-24	84	515	130	538	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	2.86e-24	84	515	130	538	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
3MI6_A	2.78e-16	313	515	331	535	ChainA, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]
4FNQ_A	6.25e-16	272	608	284	630	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
4FNR_A	4.33e-15	272	608	284	630	Crystalstructure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_B Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_C Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus],4FNR_D Crystal structure of GH36 alpha-galactosidase AgaA from Geobacillus stearothermophilus [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1UB44	6.75e-24	84	515	130	538	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	1.04e-21	106	607	152	631	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
P16551	1.71e-17	134	532	130	508	Alpha-galactosidase OS=Escherichia coli OX=562 GN=rafA PE=1 SV=1
Q9ALJ4	2.37e-14	272	608	284	630	Alpha-galactosidase AgaA OS=Geobacillus stearothermophilus OX=1422 GN=agaA PE=1 SV=1
B8NWY6	7.33e-14	100	591	166	625	Probable alpha-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=aglC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002148_00526.